Can I make Air Fryer Crispy Tandoori Chicken Wings ahead of time?

You can prep the ingredients and seasoning ahead, but air fry close to serving for the best texture.

How do I keep this recipe from turning soggy?

Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.

Can I adjust the seasoning?

Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.

How do I know the s chicken wings is done?

Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Back to Recipes

Chicken

Air Fryer Crispy Tandoori Chicken Wings

Name: Air Fryer Crispy Tandoori Chicken Wings
Prep time: 15 min
Cook time: 20 min
Total time: 35 min
Yield: 4 servings
Cuisine: Indian
Ingredients: 2 lbs chicken wings, tips removed and wings separated into flats and drumettes; 3/4 cup plain Greek yogurt (preferably low-fat); 2 tablespoons lemon juice; 1 tablespoon ginger-garlic paste; 1 tablespoon olive oil; 1 tablespoon garam masala; 1 tablespoon smoked paprika; 1 teaspoon ground cumin; 1 teaspoon ground coriander; 1/2 teaspoon turmeric powder; 1/2 teaspoon chili powder (adjust to taste for spice level); 1 teaspoon salt; 1/2 teaspoon black pepper; Fresh cilantro (for garnish, optional); Lemon wedges (for serving)

By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished Mar 24, 2026 · Updated Jun 16, 2026

Indian 35 mins air-fryer-friendlyspicycrisphigh-proteinhealthyeasykid-friendlyweeknight-dinnerv2

Boldly spiced, tender, and crispy chicken wings made in the air fryer with authentic Indian tandoori spices. A healthy, kid-friendly, and high-protein option perfect for quick and easy weeknight dinners or snacks.

Prep 15 min

Cook 20 min

Total 35 min

Servings 4

Difficulty easy

Cuisine Indian

Ingredients

Servings 4

2 lbs chicken wings, tips removed and wings separated into flats and drumettes
3/4 cup plain Greek yogurt (preferably low-fat)
2 tablespoons lemon juice
1 tablespoon ginger-garlic paste
1 tablespoon olive oil
1 tablespoon garam masala
1 tablespoon smoked paprika
1 teaspoon ground cumin
1 teaspoon ground coriander
1/2 teaspoon turmeric powder
1/2 teaspoon chili powder (adjust to taste for spice level)
1 teaspoon salt
1/2 teaspoon black pepper
Fresh cilantro (for garnish, optional)
Lemon wedges (for serving)

Ingredients for Air Fryer Crispy Tandoori Chicken Wings

Instructions

Pat the chicken wings dry with paper towels to help the marinade adhere and ensure maximum crispiness.
In a large bowl, whisk together Greek yogurt, lemon juice, ginger-garlic paste, olive oil, garam masala, smoked paprika, ground cumin, ground coriander, turmeric powder, chili powder, salt, and black pepper to create a smooth marinade.
Add the chicken wings to the marinade and toss thoroughly to coat each wing evenly. Cover and refrigerate for at least 2 hours, or overnight for enhanced flavor.
Preheat the air fryer to 400°F (200°C) for 5 minutes.
Arrange the marinated wings in a single layer in the air fryer basket, avoiding overlap to promote even airflow and crispiness. Cook in batches if necessary.
Air fry the wings for 18-20 minutes at 400°F (200°C), flipping halfway through to ensure uniform crisping and golden color.
Check doneness; wings should be crispy outside and reach an internal temperature of 165°F (74°C). Add 2-3 more minutes if needed for extra crispiness.
Remove wings from the air fryer and let rest for 2 minutes to allow moisture to evaporate, preserving the crisp texture.
Garnish with chopped fresh cilantro and serve with lemon wedges for a bright, zesty finish.
Savor these healthy, flavorful, and crispy Air Fryer Crispy Tandoori Chicken Wings as a satisfying snack or main dish.

Air Fryer Crispy Tandoori Chicken Wings cooking in the air fryer

Tips

Air Fryer Model Notes

Cook Air Fryer Crispy Tandoori Chicken Wings in a single layer when possible. Basket models may need batches; oven-style models may need a tray rotation halfway through for even browning.

Crispiness Control

Pat the s chicken wings dry, avoid crowding, and use only a light coat of oil or sauce before cooking. Add wet sauces near the end when you want the outside to stay crisp.

Doneness Cues

Look for browned edges, a hot center, and the texture described in the instructions. For meat or seafood, confirm doneness with a thermometer instead of relying only on color.

Reheat In The Air Fryer

Reheat leftovers at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating.

Frequently Asked Questions

Can I make Air Fryer Crispy Tandoori Chicken Wings ahead of time?: You can prep the ingredients and seasoning ahead, but air fry close to serving for the best texture.
How do I keep this recipe from turning soggy?: Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.
Can I adjust the seasoning?: Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.
How do I know the s chicken wings is done?: Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Ingredient Replacements

Customize these Air Fryer Crispy Tandoori Chicken Wings to fit dietary needs or ingredient availability with these simple substitutions:

Chicken Wings: Swap for chicken drumsticks or boneless thighs for different textures. For a vegetarian option, use cauliflower florets or tofu cubes marinated in the same spice blend and air fried until crispy.
Greek Yogurt: Replace with dairy-free coconut or almond yogurt to make the recipe dairy-free and vegan. For a lower-fat version, opt for plain low-fat yogurt.
Ginger-Garlic Paste: If unavailable, finely grate fresh ginger and garlic or use 1 teaspoon each of ginger powder and garlic powder.
Olive Oil: Substitute with avocado oil or melted coconut oil, both suitable for high-heat cooking and crispiness.
Spices: If smoked paprika is unavailable, use regular paprika or combine sweet paprika with a pinch of cayenne for heat. Garam masala can be swapped with curry powder—adjust spices to maintain warm, spicy flavors.
Chili Powder: Adjust spice with cayenne pepper, red pepper flakes, or sweet paprika for a milder flavor, especially for kids.

These flexible ingredient swaps let you enjoy a delicious, crispy air-fried Indian-inspired dish tailored to your preferences, including vegan, dairy-free, or low-fat variations, without sacrificing flavor or texture.

Storage

Store leftover Air Fryer Crispy Tandoori Chicken Wings in an airtight container in the refrigerator for up to 3 days. Cool the food before sealing so excess steam does not soften the texture.

Freeze only if the main ingredient and coating are freezer-friendly. Wrap tightly and freeze for up to 1 month, then thaw overnight in the refrigerator before reheating.

Reheat in the air fryer at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating for the best flavor.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Air Fryer Crispy Tandoori Chicken Wings

Recipe Details

Ingredients

Instructions