Airfryfeast

Sides

Air Fryer Crispy Baked Polenta Cakes with Roasted Red Pepper Sauce

By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished Apr 6, 2026 · Updated May 12, 2026
Italian 27 mins air-fryer-friendlyvegetariangluten-freehealthyeasycrispfamily-friendlysavorybudget-friendly30-minutes-or-lesscomfort-food

These golden and crispy polenta cakes are cooked to perfection in the air fryer, making a quick and healthy Italian-inspired side. Paired with a vibrant roasted red pepper sauce, this vegetarian and gluten-free recipe is budget-friendly and perfect for family meals.

Air Fryer Crispy Baked Polenta Cakes with Roasted Red Pepper Sauce
Prep 15 min
Cook 12 min
Total 27 min
Servings 4
Difficulty easy
Cuisine Italian

Recipe Details

Prep15 min
Cook12 min
Total27 min
Servings4
Difficultyeasy
CuisineItalian
Add To Favorites

Ingredients

Servings 4
  • 1 cup yellow cornmeal (polenta)
  • 4 cups water
  • 1 teaspoon salt
  • 2 tablespoons grated Parmesan cheese (optional for vegetarian; omit for vegan)
  • 1 tablespoon olive oil, plus extra for greasing and brushing
  • 1/2 teaspoon garlic powder
  • 1/4 teaspoon black pepper
  • 1 large egg (or flax egg for vegan: 1 tablespoon ground flaxseed mixed with 3 tablespoons water, set 5 minutes)
  • 1 cup roasted red peppers, drained
  • 1 small garlic clove, minced
  • 1 tablespoon extra virgin olive oil
  • 1 teaspoon red wine vinegar
  • 1/2 teaspoon smoked paprika
  • Salt and pepper, to taste
  • Fresh basil or parsley for garnish (optional)

Instructions

  1. In a medium saucepan, bring 4 cups of water and 1 teaspoon of salt to a gentle boil over medium heat.
  2. Slowly whisk in the cornmeal, reducing heat to low. Stir continuously to prevent lumps and cook until thickened and creamy, about 8-10 minutes.
  3. Remove from heat; stir in Parmesan cheese (if using), 1 tablespoon olive oil, garlic powder, and black pepper. Allow mixture to cool slightly for 5 minutes.
  4. Once the polenta is warm but not hot, stir in the egg or flax egg until well combined.
  5. Line a rimmed baking sheet with parchment paper and lightly grease with olive oil.
  6. Pour the polenta mixture onto the sheet and spread evenly to about 1/2-inch thickness. Refrigerate for at least 15 minutes until firm (can prep ahead and chill longer).
  7. While the polenta chills, prepare the roasted red pepper sauce: add roasted red peppers, garlic, olive oil, red wine vinegar, smoked paprika, salt, and pepper to a blender or food processor. Blend until smooth and creamy. Adjust seasoning as needed. Set aside.
  8. Once firm, carefully cut the polenta slab into 8 equal square or round cakes using a spatula or knife.
  9. Preheat air fryer to 400°F (200°C). Lightly brush or spray each polenta cake with olive oil on both sides.
  10. Place cakes in the air fryer basket in a single layer (cook in batches if necessary). Cook for 6 minutes, then carefully flip and cook an additional 6 minutes, or until golden brown and crispy on both sides.
  11. Remove from air fryer and serve warm with a generous drizzle or side of roasted red pepper sauce. Garnish with fresh basil or parsley if desired.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

Customize your Air Fryer Crispy Baked Polenta Cakes to fit your dietary preferences or pantry availability with these simple substitutions:

  • Cornmeal (Polenta): Use instant polenta for faster prep or fine yellow cornmeal for a creamier texture. Ensure gluten-free certification if needed.
  • Parmesan Cheese: Omit for vegan versions or replace with nutritional yeast to maintain a savory cheese flavor without dairy.
  • Egg (or Flax Egg): Use the flax egg as described, or substitute a chia egg (1 tablespoon chia seeds + 3 tablespoons water, set 5 minutes) for vegan options.
  • Olive Oil: Replace with avocado oil or melted coconut oil for different flavors while keeping the dish healthy.
  • Roasted Red Peppers: Swap with fire-roasted tomatoes for a smoky taste or jarred roasted sweet red peppers if fresh are unavailable.
  • Red Wine Vinegar: Apple cider vinegar or lemon juice work well to maintain acidity in the sauce.

These replacements allow you to maintain the recipe’s vegetarian, gluten-free, and healthy attributes while adapting to vegan, low-fat, or pantry-friendly needs. Enjoy this quick, budget-friendly, and family-friendly side tailored to your taste.

Air Fryer Model Notes

This recipe is crafted to work well across most air fryer models. Use these tailored tips to get perfectly crispy, golden polenta cakes every time:

  • Basket-style Air Fryers: Arrange cakes in a single layer without overcrowding for even air circulation. Cook in batches if needed to keep them crispy and evenly browned.
  • Oven-style or Toaster Oven Air Fryers: Larger capacity and multiple racks allow all cakes to cook simultaneously. Rotate trays halfway for even crisping and watch carefully for heat variations.
  • Digital vs. Manual Controls: Digital temperature settings offer precise control at 400°F (200°C). For manual or older models, adjust cooking times slightly to prevent under- or over-browning.
  • Airflow Intensity: Stronger fans crisp food faster—check cakes a minute or two prior to suggested times if your air fryer is powerful.
  • Preheating: Ensure the air fryer reaches 400°F (200°C) before cooking to achieve the perfect crispy exterior and creamy interior.

These adjustments ensure your polenta cakes come out deliciously crisp and flavorful no matter your air fryer type.

Crispiness Control

Achieve an ideal balance of crispy exterior and creamy interior with these expert tips for your Air Fryer Crispy Baked Polenta Cakes. This recipe’s focus on being healthy, air-fryer-friendly, gluten-free, and family-friendly means maintaining texture without excess fat:

  • Oil Usage: Lightly brush or spray olive oil on both sides before air frying to enhance crispness while keeping the dish low-fat and healthy.
  • Cooking Temperature: Preheat the air fryer to 400°F (200°C) to develop a golden crust quickly within the 12-minute cook time.
  • Flip Timing: Flip cakes halfway through cooking (at 6 minutes) to ensure consistent crisping on both sides.
  • Polenta Thickness: Set the polenta to about 1/2 inch thick before chilling. Thinner cakes crisp faster; thicker ones yield creamier centers but need careful timing.
  • Chilling: Refrigerate the polenta until firm (at least 15 minutes) for easier flipping and a better crispy texture.
  • Adjust Crispiness: To deepen crispiness, add 1-2 minutes per side, watching closely to prevent burning; for softer cakes, reduce cook time slightly or oil one side only.
  • Batch Size: Avoid overcrowding the basket to maintain hot air circulation and crispness. Cook in batches if needed.

Controlling oil, temperature, and timing lets you customize crispness while keeping this dish a healthy, savory comfort food for the whole family.

Preserve the delicious crispness of your crispy baked polenta cakes by reheating them in the air fryer, which maintains their texture better than microwaving or oven warming.

Reheating Steps:

  1. Preheat your air fryer to 350°F (175°C).
  2. Place leftover polenta cakes in a single layer with space for even airflow.
  3. Lightly spray or brush each cake with olive oil to restore crispness.
  4. Heat for 4-5 minutes, then flip and warm another 3-4 minutes until hot and crispy.

Avoid overcrowding so each cake reheats evenly. Monitor to prevent drying or over-browning.

Additional Tips:

  • Storage: Refrigerate cakes in airtight containers up to 3 days or freeze for up to 1 month.
  • Frozen Cakes: Reheat from frozen at 350°F (175°C) for 8-10 minutes, flipping once.
  • Moisture: Keep temperature moderate to retain creamy centers without drying them out.
  • Sauce: Warm the roasted red pepper sauce separately and serve alongside reheated cakes to keep vibrant flavors.

This reheating method ensures your polenta cakes stay crispy, creamy, and delicious — perfect for quick leftovers that fit a health-conscious, vegetarian lifestyle.

What To Serve With This In The Air Fryer

Pair these Air Fryer Crispy Baked Polenta Cakes with Roasted Red Pepper Sauce with other flavorful air fryer-friendly dishes for a balanced and satisfying meal. Consider these complementary recipes:

  • Air Fryer Roasted Vegetables: A colorful mix of zucchini, cherry tomatoes, and bell peppers seasoned with Italian herbs offers a nutritious and vibrant side.
  • Air Fryer Garlic Parmesan Asparagus: Lightly crisp asparagus spears coated in garlic and Parmesan complement the creamy polenta while keeping the meal low-carb.
  • Air Fryer Crispy Chickpeas: Add a crunchy, high-protein, snackable side that is both vegetarian and gluten-free for texture variety.
  • Air Fryer Stuffed Mushrooms: Filled with cheese, herbs, and breadcrumbs, these family-friendly mushrooms add a savory depth to your plate.
  • Air Fryer Greek Salad: Fresh cucumbers, tomatoes, olives, and feta with olive oil and lemon bring brightness and balance.

Focusing on fresh and plant-based sides keeps the meal vegetarian, gluten-free, and healthy, while complementing the comforting polenta cakes. These quick, easy ideas are perfect for weeknight dinners or family gatherings.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Airfryfeast.