How do I keep this recipe from turning soggy?

Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.

Can I adjust the seasoning?

Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.

How do I know the canned chickpeas is done?

Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Back to Recipes

Snacks

Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits

Name: Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits
Prep time: 10 min
Cook time: 15 min
Total time: 25 min
Yield: 6 servings
Cuisine: North African
Ingredients: 1 cup canned chickpeas, drained and rinsed; 1/2 cup chickpea flour (besan); 1 small fennel bulb, finely chopped (about 1/2 cup); 1 tablespoon harissa paste; 1 tablespoon olive oil; 2 teaspoons baking powder; 1 teaspoon ground cumin; 1/2 teaspoon smoked paprika; 1/4 teaspoon cayenne pepper (adjust to taste); 1/2 teaspoon sea salt; Black pepper to taste; 1/4 cup fresh parsley, finely chopped; 2 tablespoons water (more as needed); Cooking spray or a little olive oil for air fryer basket

By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished May 9, 2026 · Updated Jun 17, 2026

North African 25 mins air-fryer-friendlycrispyhealthyeasyvegetarianspicysnackablegluten-freekid-friendly30-minutes-or-lessv2

Discover a bold and healthy snack with crispy harissa-spiced chickpea and fennel biscuits, perfectly air-fried for a quick, gluten-free, and kid-friendly treat bursting with North African flavors.

Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits

Prep 10 min

Cook 15 min

Total 25 min

Servings 6

Difficulty easy

Cuisine North African

Ingredients

Servings 6

1 cup canned chickpeas, drained and rinsed
1/2 cup chickpea flour (besan)
1 small fennel bulb, finely chopped (about 1/2 cup)
1 tablespoon harissa paste
1 tablespoon olive oil
2 teaspoons baking powder
1 teaspoon ground cumin
1/2 teaspoon smoked paprika
1/4 teaspoon cayenne pepper (adjust to taste)
1/2 teaspoon sea salt
Black pepper to taste
1/4 cup fresh parsley, finely chopped
2 tablespoons water (more as needed)
Cooking spray or a little olive oil for air fryer basket

Ingredients for Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits

Instructions

Preheat your air fryer to 375°F (190°C) while preparing the biscuit dough.
In a food processor, combine chickpeas, chickpea flour, harissa paste, olive oil, baking powder, ground cumin, smoked paprika, cayenne pepper, sea salt, and black pepper. Pulse until mixture is well combined but still slightly chunky for texture.
Transfer the mixture to a bowl and fold in the finely chopped fennel and parsley. Gradually add water, 1 tablespoon at a time, until the mixture forms a soft, slightly sticky dough that holds together when pressed.
Grease your hands lightly with olive oil and shape the dough into 12 small biscuit rounds, about 2 inches in diameter, pressing firmly to hold shape during cooking.
Lightly grease or spray the air fryer basket. Place biscuits in a single layer with space between each to allow crisping on all sides.
Air fry at 375°F (190°C) for 12-15 minutes, flipping halfway, until golden brown and crispy on the outside.
Remove biscuits carefully and cool slightly on a wire rack to maintain crispiness.
Serve warm or at room temperature with a cooling dip such as yogurt tahini sauce, hummus, or garlic aioli for a delicious snack or appetizer.

Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits cooking in the air fryer

Tips

Air Fryer Model Notes

Cook Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits in a single layer when possible. Basket models may need batches; oven-style models may need a tray rotation halfway through for even browning.

Crispiness Control

Pat the canned chickpeas dry, avoid crowding, and use only a light coat of oil or sauce before cooking. Add wet sauces near the end when you want the outside to stay crisp.

Doneness Cues

Look for browned edges, a hot center, and the texture described in the instructions.

Reheat In The Air Fryer

Reheat leftovers at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating.

Frequently Asked Questions

Can I make Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits ahead of time?: You can prep the ingredients and seasoning ahead, but air fry close to serving for the best texture.
How do I keep this recipe from turning soggy?: Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.
Can I adjust the seasoning?: Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.
How do I know the canned chickpeas is done?: Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Ingredient Replacements

Customize the Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits to fit dietary needs or ingredient substitutions without compromising flavor or texture:

Chickpea Flour: Substitute with almond flour or gluten-free all-purpose flour to maintain gluten-free status; almond flour reduces carbs but may create a denser biscuit.
Harissa Paste: Swap for mild chili paste or a combination of smoked paprika and cayenne pepper for milder spice, suitable for sensitive palates.
Olive Oil: Use avocado or coconut oil for alternative healthy fats and subtle flavor variations.
Fennel Bulb: Replace with finely chopped celery or green bell pepper to adjust or soften the anise flavor.
Water: Substitute part of the water with plain or plant-based yogurt for creamier dough and added protein; keeping the recipe vegetarian and kid-friendly.
Baking Powder: For paleo or keto diets, replace baking powder with 1/4 teaspoon baking soda plus 1/2 teaspoon cream of tartar per teaspoon of baking powder.

These swaps help maintain the recipe’s quick, healthy, and gluten-free profile, while accommodating vegan, vegetarian, kid-friendly, and low-carb diets—all without sacrificing the biscuits’ characteristic crispiness and bold North African flair.

Storage

Store leftover Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits in an airtight container in the refrigerator for up to 3 days. Cool the food before sealing so excess steam does not soften the texture.

Freeze only if the main ingredient and coating are freezer-friendly. Wrap tightly and freeze for up to 1 month, then thaw overnight in the refrigerator before reheating.

Reheat in the air fryer at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating for the best flavor.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits

Recipe Details

Ingredients

Instructions