Cooking Techniques
Airfryfeast
Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits
By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished May 9, 2026 · Updated May 12, 2026
North African
25 mins
air-fryer-friendlycrispyhealthyeasyvegetarianspicysnackablegluten-freekid-friendly30-minutes-or-less
Discover a bold and healthy snack with crispy harissa-spiced chickpea and fennel biscuits, perfectly air-fried for a quick, gluten-free, and kid-friendly treat bursting with North African flavors.
Prep
10 min
Cook
15 min
Total
25 min
Servings
6
Difficulty
easy
Cuisine
North African
Ingredients
Servings
6
- 1 cup canned chickpeas, drained and rinsed
- 1/2 cup chickpea flour (besan)
- 1 small fennel bulb, finely chopped (about 1/2 cup)
- 1 tablespoon harissa paste
- 1 tablespoon olive oil
- 2 teaspoons baking powder
- 1 teaspoon ground cumin
- 1/2 teaspoon smoked paprika
- 1/4 teaspoon cayenne pepper (adjust to taste)
- 1/2 teaspoon sea salt
- Black pepper to taste
- 1/4 cup fresh parsley, finely chopped
- 2 tablespoons water (more as needed)
- Cooking spray or a little olive oil for air fryer basket
Instructions
-
Preheat your air fryer to 375°F (190°C) while preparing the biscuit dough.
-
In a food processor, combine chickpeas, chickpea flour, harissa paste, olive oil, baking powder, ground cumin, smoked paprika, cayenne pepper, sea salt, and black pepper. Pulse until mixture is well combined but still slightly chunky for texture.
-
Transfer the mixture to a bowl and fold in the finely chopped fennel and parsley. Gradually add water, 1 tablespoon at a time, until the mixture forms a soft, slightly sticky dough that holds together when pressed.
-
Grease your hands lightly with olive oil and shape the dough into 12 small biscuit rounds, about 2 inches in diameter, pressing firmly to hold shape during cooking.
-
Lightly grease or spray the air fryer basket. Place biscuits in a single layer with space between each to allow crisping on all sides.
-
Air fry at 375°F (190°C) for 12-15 minutes, flipping halfway, until golden brown and crispy on the outside.
-
Remove biscuits carefully and cool slightly on a wire rack to maintain crispiness.
-
Serve warm or at room temperature with a cooling dip such as yogurt tahini sauce, hummus, or garlic aioli for a delicious snack or appetizer.
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
Customize the Air Fryer Crispy Harissa-Spiced Chickpea and Fennel Biscuits to fit dietary needs or ingredient substitutions without compromising flavor or texture:
- Chickpea Flour: Substitute with almond flour or gluten-free all-purpose flour to maintain gluten-free status; almond flour reduces carbs but may create a denser biscuit.
- Harissa Paste: Swap for mild chili paste or a combination of smoked paprika and cayenne pepper for milder spice, suitable for sensitive palates.
- Olive Oil: Use avocado or coconut oil for alternative healthy fats and subtle flavor variations.
- Fennel Bulb: Replace with finely chopped celery or green bell pepper to adjust or soften the anise flavor.
- Water: Substitute part of the water with plain or plant-based yogurt for creamier dough and added protein; keeping the recipe vegetarian and kid-friendly.
- Baking Powder: For paleo or keto diets, replace baking powder with 1/4 teaspoon baking soda plus 1/2 teaspoon cream of tartar per teaspoon of baking powder.
These swaps help maintain the recipe’s quick, healthy, and gluten-free profile, while accommodating vegan, vegetarian, kid-friendly, and low-carb diets—all without sacrificing the biscuits’ characteristic crispiness and bold North African flair.
Air Fryer Model Notes
This recipe for crispy harissa-spiced chickpea and fennel biscuits works well across most air fryer models, though cooking times and textures may vary slightly.
Basket Size and Shape: Smaller baskets may require multiple batches to avoid overcrowding, which ensures even crisping. Larger or drawer-style air fryers accommodate more biscuits at once, saving time.
Heat Source and Air Circulation: Air fryers with top-mounted heating elements and strong convection fans provide more even browning and crispness. Use medium-high airflow settings if available to achieve a crispy exterior without drying the interior.
Temperature Accuracy: Air fryer temperatures can fluctuate. Check biscuits a few minutes before or after the 12-15 minute mark at 375°F (190°C) and adjust time accordingly to avoid over- or under-cooking.
Non-Stick Surface: Use a well-coated basket or air fryer-safe parchment paper to prevent sticking, especially since the moist dough contains chickpea flour and vegetables.
Adjust batch size, timing, or temperature as needed based on your air fryer to consistently achieve crispy, flavorful biscuits—perfect for a kid-friendly, gluten-free, and quick snack.
Crispiness Control
For perfectly crispy harissa-spiced chickpea and fennel biscuits, follow these tips tailored for this snackable, gluten-free, and kid-friendly recipe:
- Temperature & Timing: Cook at 375°F (190°C) for 12-15 minutes. Add 2-3 extra minutes if you prefer a crunchier texture, watching closely to prevent drying.
- Even Spacing: Space biscuits apart to allow hot air to circulate evenly, ensuring uniform crispness.
- Light Oil Coating: Lightly brush or spray olive oil on the basket and biscuit surfaces for enhanced browning without added fat.
- Flip Halfway: Turn biscuits at the halfway point for balanced crispiness on all sides.
- Cooling: Place biscuits on a wire rack to cool and prevent steam buildup that can soften their crust.
- Moisture Level: The dough should be slightly sticky but not wet; add water gradually to maintain the right consistency.
These steps help maximize your air fryer's strengths, delivering a quick, healthy snack rich with bold North African flavors and a satisfying crunch for the entire family.
Reheat In The Air Fryer
Keep your harissa-spiced chickpea and fennel biscuits crispy and flavorful when reheating in the air fryer by following these steps:
- Preheat the air fryer to 350°F (175°C) for gentle reheating.
- Arrange biscuits in a single layer without touching to ensure even airflow and crisping.
- Air fry for 3-5 minutes, turning halfway through to restore warmth and crunch.
- Remove carefully once hot and crisp.
Tips: Avoid overheating to prevent drying the chickpea base. For refrigerated biscuits, lightly brush or spray olive oil before reheating to maintain texture. Frozen biscuits can be reheated similarly, adding 2-3 minutes and monitoring closely.
This method preserves the delicious, quick, gluten-free, and boldly flavored snack for any occasion.
What To Serve With This In The Air Fryer
These crispy harissa-spiced chickpea and fennel biscuits pair wonderfully with other air fryer favorites to create a flavorful and balanced snack spread. Try these complementary sides and dips:
- Air Fryer Garlic and Herb Sweet Potato Fries: Their natural sweetness contrasts nicely with the spicy harissa flavors and they air fry to a perfect crisp.
- Crispy Air Fryer Zucchini Chips: Light, crunchy, and low-carb, these chips refresh the palate alongside the spicy biscuits.
- Roasted Red Pepper Hummus: A creamy, colorful dip that enhances the Mediterranean-North African theme of the snack.
- Air Fryer Stuffed Mini Bell Peppers: Filled with quinoa, herbs, and feta, they add wholesome nutrition and vibrant color.
- Quick Air Fryer Falafel Bites: Protein-packed and crispy, they complement the chickpea base while adding variety.
Serve with cooling dips such as yogurt tahini sauce or garlic aioli to round out a family-friendly, flavorful snack or appetizer featuring the best of air fryer cooking.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register