How do I keep this recipe from turning soggy?

Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.

Can I adjust the seasoning?

Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.

How do I know the cooked quinoa is done?

Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Back to Recipes

Snacks

Air Fryer Spiced Asian-Style Quinoa and Mushroom Lettuce Cups

Name: Air Fryer Spiced Asian-Style Quinoa and Mushroom Lettuce Cups
Prep time: 15 min
Cook time: 10 min
Total time: 25 min
Yield: 4 servings
Cuisine: Asian Fusion
Ingredients: 1 cup cooked quinoa, cooled; 1 tablespoon avocado oil or neutral oil; 1 small onion, finely chopped; 2 garlic cloves, minced; 1 cup cremini mushrooms, finely chopped; 1 small carrot, grated; 1/2 cup water chestnuts, chopped; 2 green onions, thinly sliced; 2 tablespoons low-sodium soy sauce or tamari for gluten-free; 1 tablespoon hoisin sauce (check gluten-free if needed); 1 tablespoon rice vinegar; 1 teaspoon freshly grated ginger; 1/2 teaspoon red chili flakes (adjust to taste); Salt and black pepper, to taste; 8–10 large butter lettuce leaves or Boston lettuce cups; 1 tablespoon toasted sesame seeds, for garnish; Fresh cilantro leaves, for garnish; sliced fresh red chili or sriracha for extra heat

By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished May 11, 2026 · Updated Jun 19, 2026

Asian Fusion 25 mins air-fryer-friendlyhealthyvegetariandairy-freegluten-freesnackableeasycrispspicyfamily-friendlyv2

Light, healthy, and bursting with bold Asian-inspired flavors, these air fryer quinoa and mushroom lettuce cups are a crisp, snackable delight perfect for family gatherings or anytime cravings.

Air Fryer Spiced Asian-Style Quinoa and Mushroom Lettuce Cups

Prep 15 min

Cook 10 min

Total 25 min

Servings 4

Difficulty easy

Cuisine Asian Fusion

Ingredients

Servings 4

1 cup cooked quinoa, cooled
1 tablespoon avocado oil or neutral oil
1 small onion, finely chopped
2 garlic cloves, minced
1 cup cremini mushrooms, finely chopped
1 small carrot, grated
1/2 cup water chestnuts, chopped
2 green onions, thinly sliced
2 tablespoons low-sodium soy sauce or tamari for gluten-free
1 tablespoon hoisin sauce (check gluten-free if needed)
1 tablespoon rice vinegar
1 teaspoon freshly grated ginger
1/2 teaspoon red chili flakes (adjust to taste)
Salt and black pepper, to taste
8–10 large butter lettuce leaves or Boston lettuce cups
1 tablespoon toasted sesame seeds, for garnish
Fresh cilantro leaves, for garnish
sliced fresh red chili or sriracha for extra heat

Ingredients for Air Fryer Spiced Asian-Style Quinoa and Mushroom Lettuce Cups

Instructions

Preheat your air fryer to 350°F (175°C) for about 5 minutes.
Heat the avocado oil in a skillet over medium heat. Add the finely chopped onion and sauté until translucent, about 3 minutes.
Add the minced garlic and grated ginger, stirring for 1 minute until fragrant.
Stir in the chopped mushrooms and cook, stirring frequently, until they release their moisture and soften, about 5 minutes.
Add the grated carrot and chopped water chestnuts; cook for an additional 2 minutes.
In a medium bowl, combine the cooked quinoa, sautéed vegetable mixture, green onions, soy sauce, hoisin sauce, rice vinegar, red chili flakes, salt, and black pepper. Mix well to combine all the flavors.
Line the air fryer basket with perforated parchment paper or a clean perforated liner to prevent sticking. Spoon the quinoa and mushroom mixture evenly into the basket.
Air fry for 8–10 minutes at 350°F (175°C), shaking the basket halfway through to ensure even crisping. The mixture should develop lightly crispy edges while remaining tender inside.
Carefully remove from the air fryer and let cool for a minute.
Scoop a generous tablespoon of the spiced quinoa and mushroom mixture into each butter lettuce leaf.
Garnish with toasted sesame seeds, fresh cilantro leaves, and optional sliced fresh chili or a drizzle of sriracha for extra heat.
Serve immediately as a vibrant, crisp, and spicy snack or appetizer.

Air Fryer Spiced Asian-Style Quinoa and Mushroom Lettuce Cups cooking in the air fryer

Tips

Air Fryer Model Notes

Cook Air Fryer Spiced Asian-Style Quinoa and Mushroom Lettuce Cups in a single layer when possible. Basket models may need batches; oven-style models may need a tray rotation halfway through for even browning.

Crispiness Control

Pat the cooked quinoa dry, avoid crowding, and use only a light coat of oil or sauce before cooking. Add wet sauces near the end when you want the outside to stay crisp.

Doneness Cues

Look for browned edges, a hot center, and the texture described in the instructions.

Reheat In The Air Fryer

Reheat leftovers at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating.

Frequently Asked Questions

Can I make Air Fryer Spiced Asian-Style Quinoa and Mushroom Lettuce Cups ahead of time?: You can prep the ingredients and seasoning ahead, but air fry close to serving for the best texture.
How do I keep this recipe from turning soggy?: Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.
Can I adjust the seasoning?: Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.
How do I know the cooked quinoa is done?: Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Ingredient Replacements

Customize these Air Fryer Spiced Asian-Style Quinoa and Mushroom Lettuce Cups to suit dietary needs or ingredient availability with these substitutions:

Quinoa: Swap with cooked couscous, bulgur wheat, or cauliflower rice as a low-carb or texture variation.
Avocado Oil: Use toasted sesame or light olive oil to deepen Asian flavor notes.
Mushrooms: Substitute cremini with shiitake or portobello mushrooms for richer umami, or use crumbled tofu for extra vegan protein.
Water Chestnuts: Replace with finely diced celery or jicama to maintain crunch and freshness.
Soy Sauce / Tamari: Use coconut aminos for a gluten-free, lower sodium alternative.
Hoisin Sauce: Substitute with black bean sauce mixed with a touch of maple syrup or agave for a vegan, gluten-free option.
Butter Lettuce Leaves: Use iceberg lettuce, napa cabbage, or collard greens as sturdy, crisp vessels.
Garnishes: Swap fresh cilantro with Thai basil or mint, and replace sesame seeds with chopped peanuts for different flavor profiles.

These swaps preserve the fresh, crisp texture and savory, spicy flavors while accommodating gluten-free, vegan, low-fat, and low-carb diets.

Storage

Store leftover Air Fryer Spiced Asian-Style Quinoa and Mushroom Lettuce Cups in an airtight container in the refrigerator for up to 3 days. Cool the food before sealing so excess steam does not soften the texture.

Freeze only if the main ingredient and coating are freezer-friendly. Wrap tightly and freeze for up to 1 month, then thaw overnight in the refrigerator before reheating.

Reheat in the air fryer at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating for the best flavor.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Air Fryer Spiced Asian-Style Quinoa and Mushroom Lettuce Cups

Recipe Details

Ingredients

Instructions