Cooking Techniques
Airfryfeast
Air Fryer Gluten-Free Blueberry Muffins with Lemon Zest
By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished Apr 19, 2026 · Updated May 12, 2026
American
25 mins
air-fryer-friendlygluten-freevegetarianhealthyeasysweetsnackablefamily-friendly30-minutes-or-lessbudget-friendly
Quick and easy gluten-free blueberry muffins baked in your air fryer, featuring bright lemon zest for a fresh citrus flavor. These soft, tender muffins make a healthy, snackable treat that’s perfect for families and anyone seeking a gluten-free, sweet snack under 30 minutes.
Prep
10 min
Cook
15 min
Total
25 min
Servings
6
Difficulty
easy
Cuisine
American
Ingredients
Servings
6
- 1 cup gluten-free all-purpose flour blend (with xanthan gum included)
- 1/2 cup almond flour
- 1/2 cup granulated sugar or coconut sugar
- 1 teaspoon baking powder
- 1/2 teaspoon baking soda
- 1/4 teaspoon salt
- 1 large egg
- 1/3 cup unsweetened almond milk (or any milk of choice)
- 1/4 cup plain Greek yogurt or dairy-free yogurt
- 1/4 cup melted coconut oil or vegetable oil
- 1 teaspoon pure vanilla extract
- Zest of 1 medium lemon
- 3/4 cup fresh or frozen blueberries (do not thaw if frozen)
Instructions
-
Preheat your air fryer to 350°F (175°C) for about 5 minutes.
-
In a large bowl, whisk together the gluten-free all-purpose flour, almond flour, sugar, baking powder, baking soda, and salt until evenly combined.
-
In a separate bowl, beat the egg and stir in the almond milk, Greek yogurt, melted coconut oil, vanilla extract, and lemon zest.
-
Pour the wet ingredients into the dry ingredients and gently fold with a spatula until just combined—avoid overmixing to maintain muffin tenderness.
-
Fold in the blueberries carefully, ensuring even distribution throughout the batter.
-
Prepare a silicone muffin tray or heat-safe muffin cups that fit your air fryer basket by lining with paper liners or lightly greasing.
-
Spoon the batter evenly into 6 muffin cups, filling each about 3/4 full.
-
Place the muffin tray in the air fryer basket and cook at 350°F (175°C) for 14-16 minutes. Check doneness using a toothpick inserted into the center; it should come out clean.
-
Carefully remove the tray from the air fryer and let the muffins cool for 5 minutes, then transfer to a wire rack to cool completely.
-
Serve warm or at room temperature as a wholesome, sweet, and gluten-free snack.
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
Customize these gluten-free blueberry muffins to suit your dietary preferences or to add variety, all while keeping the recipe air fryer-friendly and health-conscious.
- Flour: Replace the gluten-free all-purpose flour with oat flour or a blend of rice flour and tapioca starch for grain-free alternatives.
- Almond Flour: Substitute with sunflower seed flour or hazelnut flour for nut-free or alternative nut flavors.
- Sugar: Use honey or maple syrup instead of granulated or coconut sugar—reduce liquids slightly if doing so.
- Egg: For a vegan option, use a flaxseed egg (1 tbsp ground flaxseed + 3 tbsp water) or a commercial egg replacer to maintain moisture and structure.
- Milk: Any plant-based milk (oat, soy, coconut) works well with no baking adjustments needed.
- Yogurt: Swap Greek yogurt for coconut or other dairy-free yogurts to keep the muffins dairy-free.
- Oil: Vegetable or light olive oil can substitute coconut oil for similar moisture and a neutral flavor.
- Blueberries: Fresh or frozen raspberries or blackberries offer a tasty berry variation with juicy bursts.
- Citrus Zest: Use orange or lime zest instead of lemon zest for a different bright citrus note.
These alternatives help accommodate vegan, dairy-free, nut-free, and grain-free diets while preserving the muffins’ easy, healthy, and family-friendly appeal.
Air Fryer Model Notes
This gluten-free blueberry muffin recipe is crafted to work well with various air fryer models. However, differences in basket size, heating elements, and airflow can affect baking results and times.
- Basket Size & Shape: Smaller air fryers may require baking fewer muffins per batch to ensure even heat circulation and uniform browning.
- Temperature Accuracy: Air fryer temperatures can vary; using an external thermometer helps maintain the ideal 350°F (175°C) for perfect muffin texture.
- Heating Element Position: Top-mounted elements promote golden tops. If your model has side or bottom heating, rotate the muffin tray midway through baking for even cooking.
- Airflow & Fan Speed: Moderate fan speed allows the muffins to bake tenderly without drying out edges, preserving the soft crumb.
- Basket vs Tray: A silicone muffin tray fitting your air fryer basket ensures uniform baking and easy removal. Alternatively, heat-safe individual muffin cups are a good option.
Start with recommended times and temperatures but adjust slightly based on your air fryer’s characteristics to achieve consistently moist, golden, and tender muffins.
Crispiness Control
Although blueberry muffins are typically soft, you can influence the exterior texture when baking in your air fryer to achieve a gentle golden crust without sacrificing tenderness.
- Maintain 350°F (175°C): This temperature balances browning with moist crumb. Higher heat risks drying out, lower heat extends baking time.
- Bake 14-16 minutes: Follow the timing, checking early to avoid overcooking the edges.
- Use silicone muffin trays: They promote even heat distribution, preventing overly crisp or hard muffin sides.
- Coconut oil in batter: Helps produce a tender crumb and subtle sheen; avoid extra oil or sprays which could increase undesired crispness.
- Cooling: Let muffins sit in the tray 5 minutes before transferring to a rack to avoid steaming soft sides.
This approach yields muffins with a soft, sweet bite and a gently golden, tender exterior—ideal for snackable, family-friendly gluten-free treats.
Reheat your gluten-free blueberry muffins quickly in the air fryer to enjoy a warm, moist interior with a slightly crisp exterior—perfect for preserving their fresh-baked appeal.
Reheating Instructions:
- Preheat the air fryer to 320°F (160°C) for 3-4 minutes for even warming.
- Arrange muffins in a single layer with space for air circulation in the basket.
- Heat for 3-5 minutes, checking after 3 minutes to prevent drying out; muffins should be warmed through with a light crisp top.
- Optionally, loosely cover muffins with aluminum foil to retain moisture during reheating without softening the exterior.
Tips for Best Results:
- Avoid over-heating: Gluten-free baked goods dry quickly; keep reheating brief and check frequently.
- Storage: Store leftovers in airtight containers in the refrigerator to preserve freshness before reheating.
- For softer texture: Place a heat-safe ramekin with a tablespoon of water inside the air fryer to add moisture while reheating.
- Family-friendly & snackable: Makes an ideal quick warm snack or breakfast option.
This reheating method maintains the delicious texture and flavor of your gluten-free, lemony blueberry muffins every time.
What To Serve With This In The Air Fryer
These gluten-free, sweet, and citrus-infused blueberry muffins stand alone as a delicious snack but also pair wonderfully with several air fryer-friendly sides for a balanced, easy meal.
- Air Fryer Cinnamon-Spiced Apples: Soft, warm apples with cinnamon complement the lemon zest and blueberry flavors perfectly.
- Greek Yogurt Parfait Cups: Creamy Greek yogurt layered with fresh berries and gluten-free granola create a protein-packed, fresh contrast.
- Air Fryer Toasted Almonds or Walnuts: Quick-to-make crunchy nuts provide a satisfying texture and nutty flavor boost.
- Refreshing Cucumber Mint Salad: Crisp cucumber with mint and a light lemon vinaigrette offers a fresh, savory side to balance the sweetness.
These pairing options support the gluten-free, healthy, family-friendly, and quick-prep nature of your Air Fryer snack or light meal.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register