Airfryfeast

Pork

Air Fryer Low-Carb Maple Mustard Glazed Pork Tenderloin Medallions

By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished Apr 14, 2026 · Updated May 12, 2026
American 25 mins air-fryer-friendlyfreezer-friendlylow-carbgluten-freedairy-freehealthyhigh-proteineasyone-potfamily-friendlyweeknight-dinnercrispsavory

Quick and easy air fryer pork tenderloin medallions glazed with a savory low-carb maple mustard sauce. This gluten-free, dairy-free, high-protein pork recipe delivers a crisp outside and juicy center, making it perfect for weeknight dinners, meal prep, and freezer-friendly healthy meals.

Air Fryer Low-Carb Maple Mustard Glazed Pork Tenderloin Medallions
Prep 10 min
Cook 15 min
Total 25 min
Servings 4
Difficulty easy
Cuisine American

Recipe Details

Prep10 min
Cook15 min
Total25 min
Servings4
Difficultyeasy
CuisineAmerican
Add To Favorites

Ingredients

Servings 4
  • 1 lb pork tenderloin, trimmed and sliced into 1-inch medallions
  • 1 tablespoon olive oil
  • Salt and freshly ground black pepper, to taste
  • 1 tablespoon Dijon mustard
  • 1 tablespoon sugar-free maple syrup substitute (e.g., Lakanto or ChocZero)
  • 1 teaspoon apple cider vinegar
  • 1/2 teaspoon smoked paprika
  • 1/4 teaspoon garlic powder
  • 1/4 teaspoon onion powder
  • Fresh thyme or rosemary sprigs, for garnish (optional)

Instructions

  1. Preheat your air fryer to 400°F (200°C) for 5 minutes.
  2. Pat the pork medallions dry with paper towels. Lightly coat them with olive oil, then season both sides with salt, black pepper, smoked paprika, garlic powder, and onion powder.
  3. In a small bowl, whisk together Dijon mustard, sugar-free maple syrup substitute, and apple cider vinegar until smooth to create the glaze.
  4. Arrange the pork medallions in a single layer in the air fryer basket. Air fry at 400°F for 7 minutes.
  5. Flip the medallions carefully using tongs or a spatula. Brush tops generously with the maple mustard glaze.
  6. Continue air frying for another 6 to 8 minutes until the internal temperature reaches 145°F (63°C) and the exterior is crispy and caramelized. Brush the glaze once more halfway through the second cooking stage for extra flavor.
  7. Remove the pork medallions from the air fryer and let rest for 3 minutes to lock in juices.
  8. Garnish with fresh thyme or rosemary if desired, then serve immediately with your favorite low-carb sides or store cooled medallions in an airtight container for freezer-friendly meal prep.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

Customize this recipe to suit your diet or pantry with these ingredient alternatives:

  • Pork Tenderloin: Substitute chicken breast, turkey medallions, or beef sirloin slices. For vegetarian options, consider grilled portobello mushrooms or cauliflower steaks (adjust cooking times accordingly).
  • Olive Oil: Use avocado oil or melted coconut oil, both with high smoke points ideal for air frying.
  • Dijon Mustard: Try spicy brown or whole-grain mustard for flavor variety; ensure mustard is vegan if needed.
  • Sugar-Free Maple Syrup Substitute: Replace with monk fruit syrup or allulose syrup, or use pure maple syrup if not restricting carbs.
  • Apple Cider Vinegar: Swap with white wine vinegar or lemon juice for similar acidity.
  • Smoked Paprika and Spices: Add cayenne or chili powder for heat; use sweet paprika for milder flavor.

These swaps keep the recipe low-carb, gluten-free, dairy-free, and healthy while fitting your preferences.

Air Fryer Model Notes

This low-carb maple mustard glazed pork tenderloin recipe adapts well to most air fryer models, but variations in size and technology may affect cooking time and results.

Size & Capacity: Smaller air fryers may require cooking in batches to prevent overcrowding, ensuring even crisping. Larger baskets allow cooking all medallions simultaneously for consistent results.

Heating Technology: Air fryers with rapid air circulation or convection fans crisp and caramelize the glaze faster and more evenly. Basic models may require slightly longer cook times and careful monitoring to avoid uneven browning.

Temperature Accuracy: Air fryer temperatures vary; use a meat thermometer to confirm the pork reaches the safe internal temperature of 145°F (63°C) without overcooking. If your model runs hot, reduce temperature by 10–15°F and lengthen cook time slightly.

Basket Design: Mesh baskets improve airflow but may let glaze drip through; use a tray to catch drips if possible. Solid trays with holes provide good airflow but may require mid-cook repositioning for even crisping.

Monitor your initial cooking to adjust for your air fryer’s performance, guaranteeing juicy, tender, and crisp pork medallions every time.

Crispiness Control

To perfect the crispiness of your air fryer low-carb maple mustard glazed pork tenderloin medallions, apply these tips:

  • Dry pork well: Pat medallions with paper towels before seasoning to remove moisture and promote browning.
  • Light olive oil coating: Use olive oil sparingly to encourage a golden, crispy crust without excess fat.
  • Cook at 400°F (200°C): High heat crisps the glaze and sears surface; flipping at 7 minutes ensures even cooking.
  • Apply glaze twice: Brush maple mustard glaze halfway and near the end of cooking to build a sticky, caramelized crust.
  • Avoid overcrowding: Place medallions in a single layer for optimal hot air circulation and crispness.
  • Rest before serving: Let medallions rest 3 minutes to retain juices while the crust firms.

Adjust these steps to your preference, achieving a crisp exterior with juicy, tender pork inside—ideal for a healthy, family-friendly, air-fryer pork main course.

Reheat In The Air Fryer

To reheat your low-carb maple mustard glazed pork medallions in the air fryer while keeping them juicy and crispy, follow these steps:

  1. Preheat air fryer to 350°F (175°C).
  2. Arrange pork medallions in a single layer with space for air flow.
  3. Heat for 3 to 5 minutes, flipping halfway through for even warming.
  4. Ensure internal temperature reaches at least 140°F (60°C) for safe consumption, but avoid overheating to prevent dryness.
  5. Optionally, brush a light layer of maple mustard glaze before reheating to refresh flavor and moisture.

Tips:

  • Reheat at moderate temperature to maintain crispness and juiciness.
  • Don’t overcrowd the basket to prevent steaming.
  • This method works great for quick meal prep or freezer-friendly leftovers.
  • Pair reheated medallions with low-carb sides for a balanced healthy meal.

What To Serve With This In The Air Fryer

Pair these flavorful pork tenderloin medallions with easy, healthy air fryer sides for a complete meal. Try these complementary dishes:

  • Air Fryer Roasted Brussels Sprouts: Crispy sprouts tossed with olive oil and garlic powder balance the pork's sweet and tangy glaze.
  • Air Fryer Cauliflower Rice: Lightly seasoned, crispy cauliflower florets provide a low-carb, gluten-free base.
  • Air Fryer Garlic Parmesan Green Beans: Tender green beans with dairy-free parmesan add savory depth.
  • Air Fryer Zucchini Fries: Kid-friendly, crunchy zucchini fries offer a delicious vegetable side.
  • Air Fryer Sweet Potato Wedges: Use sparingly for a subtle sweet contrast to the tart glaze.

Complement the meal with a fresh mixed green salad dressed in light vinaigrette for a quick, well-rounded weeknight dinner or meal prep option.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Airfryfeast.