How do I keep this recipe from turning soggy?

Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.

Can I adjust the seasoning?

Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.

How do I know the pork tenderloin is done?

Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Back to Recipes

Pork

Air Fryer Low-Carb Maple Mustard Glazed Pork Tenderloin Medallions

Name: Air Fryer Low-Carb Maple Mustard Glazed Pork Tenderloin Medallions
Prep time: 10 min
Cook time: 15 min
Total time: 25 min
Yield: 4 servings
Cuisine: American
Ingredients: 1 lb pork tenderloin, trimmed and sliced into 1-inch medallions; 1 tablespoon olive oil; Salt and freshly ground black pepper, to taste; 1 tablespoon Dijon mustard; 1 tablespoon sugar-free maple syrup substitute (e.g., Lakanto or ChocZero); 1 teaspoon apple cider vinegar; 1/2 teaspoon smoked paprika; 1/4 teaspoon garlic powder; 1/4 teaspoon onion powder; Fresh thyme or rosemary sprigs, for garnish (optional)

By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished Apr 14, 2026 · Updated Jun 16, 2026

American 25 mins air-fryer-friendlyfreezer-friendlylow-carbgluten-freedairy-freehealthyhigh-proteineasyone-potfamily-friendlyweeknight-dinnercrispsavoryv2

Quick and easy air fryer pork tenderloin medallions glazed with a savory low-carb maple mustard sauce. This gluten-free, dairy-free, high-protein pork recipe delivers a crisp outside and juicy center, making it perfect for weeknight dinners, meal prep, and freezer-friendly healthy meals.

Air Fryer Low-Carb Maple Mustard Glazed Pork Tenderloin Medallions

Prep 10 min

Cook 15 min

Total 25 min

Servings 4

Difficulty easy

Cuisine American

Ingredients

Servings 4

1 lb pork tenderloin, trimmed and sliced into 1-inch medallions
1 tablespoon olive oil
Salt and freshly ground black pepper, to taste
1 tablespoon Dijon mustard
1 tablespoon sugar-free maple syrup substitute (e.g., Lakanto or ChocZero)
1 teaspoon apple cider vinegar
1/2 teaspoon smoked paprika
1/4 teaspoon garlic powder
1/4 teaspoon onion powder
Fresh thyme or rosemary sprigs, for garnish (optional)

Ingredients for Air Fryer Low-Carb Maple Mustard Glazed Pork Tenderloin Medallions

Instructions

Preheat your air fryer to 400°F (200°C) for 5 minutes.
Pat the pork medallions dry with paper towels. Lightly coat them with olive oil, then season both sides with salt, black pepper, smoked paprika, garlic powder, and onion powder.
In a small bowl, whisk together Dijon mustard, sugar-free maple syrup substitute, and apple cider vinegar until smooth to create the glaze.
Arrange the pork medallions in a single layer in the air fryer basket. Air fry at 400°F for 7 minutes.
Flip the medallions carefully using tongs or a spatula. Brush tops generously with the maple mustard glaze.
Continue air frying for another 6 to 8 minutes until the internal temperature reaches 145°F (63°C) and the exterior is crispy and caramelized. Brush the glaze once more halfway through the second cooking stage for extra flavor.
Remove the pork medallions from the air fryer and let rest for 3 minutes to lock in juices.
Garnish with fresh thyme or rosemary if desired, then serve immediately with your favorite low-carb sides or store cooled medallions in an airtight container for freezer-friendly meal prep.

Air Fryer Low-Carb Maple Mustard Glazed Pork Tenderloin Medallions cooking in the air fryer

Tips

Air Fryer Model Notes

Cook Air Fryer Low-Carb Maple Mustard Glazed Pork Tenderloin Medallions in a single layer when possible. Basket models may need batches; oven-style models may need a tray rotation halfway through for even browning.

Crispiness Control

Pat the pork tenderloin dry, avoid crowding, and use only a light coat of oil or sauce before cooking. Add wet sauces near the end when you want the outside to stay crisp.

Doneness Cues

Look for browned edges, a hot center, and the texture described in the instructions. For meat or seafood, confirm doneness with a thermometer instead of relying only on color.

Reheat In The Air Fryer

Reheat leftovers at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating.

Frequently Asked Questions

Can I make Air Fryer Low-Carb Maple Mustard Glazed Pork Tenderloin Medallions ahead of time?: You can prep the ingredients and seasoning ahead, but air fry close to serving for the best texture.
How do I keep this recipe from turning soggy?: Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.
Can I adjust the seasoning?: Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.
How do I know the pork tenderloin is done?: Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Ingredient Replacements

Customize this recipe to suit your diet or pantry with these ingredient alternatives:

Pork Tenderloin: Substitute chicken breast, turkey medallions, or beef sirloin slices. For vegetarian options, consider grilled portobello mushrooms or cauliflower steaks (adjust cooking times accordingly).
Olive Oil: Use avocado oil or melted coconut oil, both with high smoke points ideal for air frying.
Dijon Mustard: Try spicy brown or whole-grain mustard for flavor variety; ensure mustard is vegan if needed.
Sugar-Free Maple Syrup Substitute: Replace with monk fruit syrup or allulose syrup, or use pure maple syrup if not restricting carbs.
Apple Cider Vinegar: Swap with white wine vinegar or lemon juice for similar acidity.
Smoked Paprika and Spices: Add cayenne or chili powder for heat; use sweet paprika for milder flavor.

These swaps keep the recipe low-carb, gluten-free, dairy-free, and healthy while fitting your preferences.

Storage

Store leftover Air Fryer Low-Carb Maple Mustard Glazed Pork Tenderloin Medallions in an airtight container in the refrigerator for up to 3 days. Cool the food before sealing so excess steam does not soften the texture.

Freeze only if the main ingredient and coating are freezer-friendly. Wrap tightly and freeze for up to 1 month, then thaw overnight in the refrigerator before reheating.

Reheat in the air fryer at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating for the best flavor.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Air Fryer Low-Carb Maple Mustard Glazed Pork Tenderloin Medallions

Recipe Details

Ingredients

Instructions