Air Fryer Cooking Guides
Airfryfeast
Air Fryer Freezer-Friendly Maple-Glazed Pork Shoulder Steaks
By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished Apr 12, 2026 · Updated Jun 16, 2026
American BBQ
35 mins
air-fryer-friendlyfreezer-friendlyhealthydairy-freegourmethigh-proteincrispeasyweeknight-dinnerv2
Tender pork shoulder steaks air fried to perfection with a rich maple BBQ glaze, delivering a crispy exterior and juicy interior. This easy, freezer-friendly, dairy-free pork recipe is high-protein and ideal for quick weeknight dinners with gourmet flair.
Prep
15 min
Cook
20 min
Total
35 min
Servings
4
Difficulty
easy
Cuisine
American BBQ
Ingredients
Servings
4
- 4 pork shoulder steaks (about 6 oz each, 1/2 inch thick)
- 1/4 cup pure maple syrup
- 2 tablespoons apple cider vinegar
- 2 tablespoons tomato paste
- 1 tablespoon Dijon mustard
- 1 teaspoon smoked paprika
- 1/2 teaspoon garlic powder
- 1/2 teaspoon onion powder
- 1/4 teaspoon cayenne pepper (optional for mild heat)
- Salt and freshly ground black pepper to taste
- 1 tablespoon olive oil (for brushing pork before air frying)
Instructions
-
In a medium bowl, whisk together maple syrup, apple cider vinegar, tomato paste, Dijon mustard, smoked paprika, garlic powder, onion powder, cayenne pepper (if using), salt, and black pepper until smooth to create the maple BBQ glaze.
-
Pat pork shoulder steaks dry with paper towels and season both sides lightly with salt and black pepper.
-
Brush pork steaks lightly with olive oil to promote crisping.
-
Preheat your air fryer to 400°F (200°C) for 5 minutes.
-
Arrange the pork steaks in a single layer in the air fryer basket, making sure not to overcrowd (cook in batches if needed).
-
Cook pork steaks at 400°F for 8 minutes.
-
Flip the steaks and generously brush the top side with the maple BBQ glaze.
-
Continue cooking for another 5 minutes.
-
Flip the steaks again, brush the other side with more glaze, then cook for 2–3 minutes more until the glaze is bubbly and slightly caramelized and internal temperature reaches 145°F (63°C).
-
Remove steaks and let rest for 5 minutes to allow juices to redistribute.
-
Serve immediately, or cool completely before placing in airtight freezer bags for freezer storage (up to 3 months). To reheat, thaw overnight and warm in air fryer at 350°F for 5–7 minutes.
Tips
Air Fryer Model Notes
Cook Air Fryer Freezer-Friendly Maple-Glazed Pork Shoulder Steaks in a single layer when possible. Basket models may need batches; oven-style models may need a tray rotation halfway through for even browning.
Crispiness Control
Pat the pork shoulder steaks dry, avoid crowding, and use only a light coat of oil or sauce before cooking. Add wet sauces near the end when you want the outside to stay crisp.
Doneness Cues
Look for browned edges, a hot center, and the texture described in the instructions. For meat or seafood, confirm doneness with a thermometer instead of relying only on color.
Reheat In The Air Fryer
Reheat leftovers at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating.
Frequently Asked Questions
- Can I make Air Fryer Freezer-Friendly Maple-Glazed Pork Shoulder Steaks ahead of time?
- You can prep the ingredients and seasoning ahead, but air fry close to serving for the best texture.
- How do I keep this recipe from turning soggy?
- Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.
- Can I adjust the seasoning?
- Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.
- How do I know the pork shoulder steaks (about 6 oz each is done?
- Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.
Ingredient Replacements
Customize this maple-glazed pork shoulder steak recipe to suit your dietary needs or pantry with these ingredient substitutions while maintaining a dairy-free, air-fryer-friendly profile:
- Pork Shoulder Steaks: Swap for pork loin chops for leaner meat, or boneless chicken thighs as a poultry alternative that crisps well.
- Pure Maple Syrup: Substitute honey or agave nectar to achieve a similar natural sweet glaze.
- Apple Cider Vinegar: Use white wine vinegar or fresh lemon juice to add bright acidity.
- Tomato Paste: Replace with tomato sauce or natural ketchup, adjusting sweetness to balance flavors.
- Dijon Mustard: Use yellow mustard or grainy whole-grain mustard for varied tang and texture.
- Smoked Paprika: Substitute with regular paprika plus a dash of liquid smoke or chipotle powder to preserve smoky depth.
- Olive Oil: Avocado oil or neutral oils like grapeseed work well for brushing and crisping.
These replacements keep the recipe healthy, budget-friendly, and adaptable without compromising its gourmet, freezer-friendly appeal.
Storage
Store leftover Air Fryer Freezer-Friendly Maple-Glazed Pork Shoulder Steaks in an airtight container in the refrigerator for up to 3 days. Cool the food before sealing so excess steam does not soften the texture.
Freeze only if the main ingredient and coating are freezer-friendly. Wrap tightly and freeze for up to 1 month, then thaw overnight in the refrigerator before reheating.
Reheat in the air fryer at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating for the best flavor.
Related Articles
Read related air fryer guides and cooking tips.
Air Fryer Cooking Guides
Air Fryer Desserts: Crisps, Cakes, and Cozy Treats
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register