Cooking Techniques
Airfryfeast
Air Fryer Italian-Style Parmesan Crispy Polenta Wedges with Marinara Dip
By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished Apr 16, 2026 · Updated May 12, 2026
Italian
25 mins
air-fryer-friendlyvegetariangluten-freehealthyeasycrispyfamily-friendlysnackablebudget-friendly30-minutes-or-less
Golden, crispy Parmesan-coated polenta wedges air fried with Italian herbs, paired with a vibrant marinara dip. This healthy, gluten-free, vegetarian side is quick, budget-friendly, and packed with authentic Italian flavor—perfect for snacks or complementing any meal.
Prep
10 min
Cook
15 min
Total
25 min
Servings
4
Difficulty
easy
Cuisine
Italian
Ingredients
Servings
4
- 1 cup quick-cooking polenta
- 3 cups water
- 1 teaspoon salt, divided
- 1/2 cup grated Parmesan cheese, divided
- 1/2 teaspoon garlic powder
- 1/2 teaspoon dried Italian seasoning
- 1/4 teaspoon black pepper
- 2 tablespoons olive oil, divided
- Fresh parsley, chopped (for garnish, optional)
- Marinara Sauce for dipping
- 1 tablespoon olive oil
- 1 small garlic clove, minced
- 1 can (14 oz) crushed tomatoes
- 1/2 teaspoon dried oregano
- 1/2 teaspoon dried basil
- Salt and pepper to taste
- Pinch of red pepper flakes (optional)
Instructions
-
In a medium saucepan, bring 3 cups of water and 1/2 teaspoon salt to a boil over medium-high heat.
-
Slowly whisk in the quick-cooking polenta. Reduce heat to low and cook, stirring constantly, until thickened, about 3-5 minutes.
-
Remove from heat and stir in 1/4 cup grated Parmesan cheese, garlic powder, Italian seasoning, and black pepper until combined.
-
Transfer the polenta mixture to a parchment-lined 8x8 inch pan. Spread evenly and smooth the surface. Sprinkle the remaining 1/4 cup Parmesan cheese on top.
-
Let the polenta cool at room temperature for 15 minutes to firm up, or refrigerate for 10 minutes to speed setting.
-
Invert the firm polenta onto a cutting board and slice into 12 even wedges (like pie slices).
-
Preheat the air fryer to 400°F (200°C) for 3 minutes.
-
Brush both sides of each wedge with olive oil.
-
Place the wedges in a single layer in the air fryer basket; cook in batches if needed to avoid overcrowding.
-
Air fry for 10-12 minutes, flipping halfway, until golden brown and crispy on the outside.
-
Meanwhile, prepare the marinara dip: heat olive oil in a small saucepan over medium heat. Add garlic and sauté until fragrant, about 30 seconds.
-
Add crushed tomatoes, oregano, basil, salt, pepper, and optional red pepper flakes. Simmer for 10 minutes, stirring occasionally, until slightly thickened.
-
Transfer marinara to a serving bowl.
-
Serve the hot polenta wedges garnished with parsley alongside the warm marinara sauce for dipping.
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
Customize this Air Fryer Italian-Style Parmesan Crispy Polenta Wedges recipe by swapping ingredients to fit your preferences or dietary needs while keeping it gluten-free, vegetarian, and family-friendly:
- Polenta: Use instant cornmeal if quick-cooking polenta is unavailable. For a low-carb option, try cooked cauliflower rice, noting the texture difference.
- Parmesan Cheese: Replace with nutritional yeast or plant-based Parmesan for a vegan or dairy-free version.
- Olive Oil: Substitute with neutral oils like avocado or grapeseed oil for brushing wedges and sautéeing the marinara garlic.
- Dried Italian Seasoning: Mix dried basil, oregano, thyme, and rosemary as an alternative to maintain Italian flavors.
- Marinara Sauce: Use store-bought marinara for convenience or switch to spicy arrabbiata sauce for a kick.
- Garlic Powder and Fresh Garlic: Swap with shallots or onion powder depending on taste preferences.
These options keep the recipe easy, budget-friendly, and adaptable while preserving its crisp, flavorful character.
Air Fryer Model Notes
This recipe for Italian-Style Parmesan Crispy Polenta Wedges performs best with an air fryer that maintains consistent high heat and good airflow to ensure an even, crispy crust. Larger baskets let you cook more wedges simultaneously, reducing batch cooking time. Smaller air fryers require multiple batches to avoid overcrowding, which can cause steaming and reduce crispiness.
Using adjustable racks or multi-layer settings in some models may increase capacity but can require longer cooking times and careful flipping to crisp wedges evenly. If your air fryer allows fan speed adjustments, selecting a higher fan speed helps produce a crunchier crust.
Since temperature calibration varies by brand and model, monitor the first batch closely and adjust cooking time or temperature slightly if needed to achieve a golden-brown exterior without drying out the tender polenta inside.
If your air fryer has a digital timer, set it for 10 minutes and flip wedges halfway through. For manual timers, use a kitchen timer to track cooking and flipping times consistently.
Following these tips tailored to your air fryer model ensures perfectly crispy, flavorful polenta wedges every time.
Crispiness Control
Achieving ideal crispiness for your Air Fryer Italian-Style Parmesan Crispy Polenta Wedges involves these practical tips for this Sides recipe, tagged air-fryer-friendly, vegetarian, gluten-free, healthy, and crispy:
- Extra crispiness: Boost the air fryer temperature slightly to 410°F (210°C) and add 1-2 minutes cooking time. Evenly brush wedges with olive oil to help Parmesan create a golden, crunchy crust.
- Lighter crisp: Follow 400°F (200°C) for 10 minutes and flip halfway to brown evenly without drying the soft inner polenta.
- Batch size: Avoid overcrowding the air fryer basket to allow proper hot air circulation, ensuring crispy exteriors on all wedges.
- Polenta firmness: Ensure polenta is fully set and firm before cutting and air frying; excess moisture reduces crispness.
- Oil choice: Olive oil complements the Italian flavor and promotes a crispy finish while keeping the dish healthy.
Adjust these factors to get satisfying, flavorful wedges perfect as a quick, budget-friendly snack or a family-friendly side with perfect crunchy texture.
Reheat leftover Air Fryer Italian-Style Parmesan Crispy Polenta Wedges in the air fryer to restore their crispiness and warmth without drying them out.
Reheating Steps:
- Preheat your air fryer to 350°F (175°C) for 3 minutes.
- Arrange wedges in a single layer in the air fryer basket to avoid overcrowding; reheat in batches if necessary.
- Heat for 5-7 minutes, flipping halfway through for even crisping.
- Check if wedges are heated through and crispy; add 1-2 minutes more if you want extra crunch.
Tips for Best Results:
- Avoid overheating: This keeps the tender inside moist while restoring crisp exterior.
- Optional: Lightly brush wedges with olive oil before reheating for enhanced flavor and texture.
- Serve promptly: Enjoy reheated wedges immediately with marinara sauce for best taste.
- Storage: Store leftovers in an airtight container refrigerated up to 3 days or freeze for 1 month. Thaw frozen wedges overnight in the fridge before reheating.
Using the air fryer to reheat keeps this gluten-free, vegetarian side deliciously crispy and satisfying, ideal for quick weeknight meals or snacks.
What To Serve With This In The Air Fryer
Pair these crispy, Italian-inspired polenta wedges with easy air fryer-friendly sides and snacks that complement their cheesy, herb-infused flavor and crunchy texture. Excellent serving options include:
- Air Fryer Roasted Vegetables: Zucchini, bell peppers, or asparagus tossed with olive oil and Italian herbs make a colorful, healthy side.
- Air Fryer Garlic Parmesan Brussels Sprouts: Their buttery, garlicky flavor mirrors the Parmesan notes in the wedges and adds nutritious greens.
- Air Fryer Crispy Chickpeas: A crunchy, high-protein vegetarian snack seasoned with Italian spices or smoked paprika for a flavor boost.
- Air Fryer Caprese Skewers: Cherry tomatoes, fresh mozzarella, and basil leaves drizzled with olive oil and balsamic glaze provide a fresh, light pairing.
- Air Fryer Stuffed Mushrooms: Mushroom caps filled with breadcrumbs, Parmesan, garlic, and herbs offer an elegant Italian touch.
For a heartier meal, serve alongside air-fried proteins such as Italian-Seasoned Air Fryer Chicken Thighs or Air Fryer Lemon Herb Salmon for a complete, balanced, and flavorful dinner.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register