Cooking Techniques
Airfryfeast
Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw
By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished Mar 31, 2026 · Updated May 12, 2026
Southern American
22 mins
air-fryer-friendlyspicyquickeasyhealthygluten-freehigh-proteincrispfamily-friendlyweeknight-dinner30-minutes-or-lesssavory
Enjoy a healthy and crispy Southern American classic with these Air Fryer Spicy Cajun Catfish Tacos topped with a zesty lime slaw. This quick and easy gluten-free recipe is high in protein and bursting with bold Cajun spices, making it perfect for a family-friendly, weeknight seafood dinner.
Prep
10 min
Cook
12 min
Total
22 min
Servings
4
Difficulty
easy
Cuisine
Southern American
Ingredients
Servings
4
- 1 lb catfish fillets, cut into 4-5 strips
- 1 tablespoon Cajun seasoning
- 1 teaspoon smoked paprika
- 1/2 teaspoon garlic powder
- 1/2 teaspoon onion powder
- 1/4 teaspoon cayenne pepper (adjust to taste)
- 1/2 teaspoon salt
- 1/4 teaspoon black pepper
- 1 large egg
- 1/2 cup gluten-free breadcrumbs or crushed gluten-free cornflakes
- 1 tablespoon olive oil
- 6 small corn tortillas, warmed
- 1 cup shredded green cabbage
- 1/2 cup shredded red cabbage
- 1/4 cup grated carrot
- 2 tablespoons finely chopped fresh cilantro
- Juice of 1 lime
- 1 tablespoon Greek yogurt or dairy-free yogurt
- 1 teaspoon honey or maple syrup
- Salt and pepper to taste
- Lime wedges, for serving
Instructions
-
Preheat your air fryer to 400°F (200°C) for 5 minutes.
-
In a shallow bowl, whisk the egg until well beaten.
-
In a separate bowl, combine Cajun seasoning, smoked paprika, garlic powder, onion powder, cayenne pepper, salt, black pepper, and gluten-free breadcrumbs.
-
Dip each catfish strip into the beaten egg, then coat thoroughly with the seasoned breadcrumb mixture.
-
Lightly spray or brush the catfish strips with olive oil to help them crisp up in the air fryer.
-
Place the coated catfish strips in a single layer in the air fryer basket. Cook for 10-12 minutes, flipping halfway through, until golden brown and cooked through.
-
While the catfish cooks, prepare the lime slaw by mixing shredded green cabbage, red cabbage, grated carrot, and cilantro in a bowl.
-
In a small bowl, whisk together lime juice, yogurt, honey or maple syrup, salt, and pepper. Pour this dressing over the slaw and toss well to combine.
-
Warm the corn tortillas on a dry skillet or in the air fryer for 1-2 minutes until pliable.
-
Assemble the tacos by placing 1-2 catfish strips on each tortilla, topping with a generous scoop of lime slaw. Serve immediately with lime wedges on the side.
-
Enjoy your spicy, crunchy, and flavorful Cajun catfish tacos!
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
Customize your Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw to suit dietary needs or ingredient availability without sacrificing flavor or texture:
- Catfish: Substitute with firm white fish like cod, tilapia, or haddock for similar texture and flavor.
- Cajun Seasoning: For milder spice, replace with smoked paprika blends or chili powder mixed with oregano.
- Gluten-Free Breadcrumbs: Use crushed gluten-free cornflakes, almond flour for low-carb diets, or crushed pork rinds for ketogenic options.
- Egg: Replace with aquafaba (chickpea water) or a flax egg (1 tbsp ground flaxseed + 3 tbsp water) for vegan or egg-free versions.
- Olive Oil: Avocado or light vegetable oil work well for a neutral flavor and high smoke point.
- Corn Tortillas: Swap with lettuce wraps or low-carb tortillas for paleo or ketogenic diets.
- Greek Yogurt: Use dairy-free yogurt alternatives, such as coconut or almond-based options, for a creamy, dairy-free dressing.
- Honey or Maple Syrup: Substitute with agave syrup or sugar-free sweeteners to lower sugar content.
These substitutions maintain a quick, healthy, and delicious taco experience, preserving the signature crispiness and bold Cajun taste with a tangy lime slaw.
Air Fryer Model Notes
The type and capacity of your air fryer can affect cooking time and texture when making these Spicy Cajun Catfish Tacos. Smaller air fryers with limited basket space may require cooking the fish strips in batches to ensure even air circulation and optimal crispiness. Larger or convection models may cook the catfish more evenly and quickly, potentially reducing cooking time by a minute or two.
Adjust cook times based on your specific model’s heat distribution. Since some air fryers brown coatings rapidly, check the catfish around 8-10 minutes to avoid overcooking. Non-stick or perforated baskets improve airflow and crispiness, essential for a crunchy crust without extra oil.
If your air fryer lacks a flip reminder, manually turn the catfish strips halfway through cooking for even browning. Use a low-heat or warming setting to gently warm the tortillas without drying them out.
These tips help you get consistently crispy, flavorful tacos while keeping them family-friendly, gluten-free, and high-protein.
Crispiness Control
Follow these expert tips to achieve perfect crispiness with your Air Fryer Spicy Cajun Catfish Tacos, keeping the recipe air-fryer-friendly, gluten-free, high-protein, and quick.
- Light Oil Coating: Brush or lightly spray olive oil on catfish strips before air frying to enhance crunch without adding excess fat.
- Ensure Proper Airflow: Arrange catfish in a single layer with space between pieces for even hot air circulation and crisping.
- Adjust Cooking Time: Cook for 10 minutes for a tender crust; extend to 12-14 minutes with flipping halfway for extra crunch.
- Choose Breadcrumbs Wisely: Crushed gluten-free cornflakes deliver a crunchier texture; fine gluten-free breadcrumbs produce a lighter crisp.
- Preheat the Air Fryer: Preheating to 400°F ensures the coating crisps quickly, sealing in moisture.
- Reheating: Reheat catfish strips at 350°F for 3-4 minutes in the air fryer (without slaw) to maintain crispness.
Customize the crispiness to your family’s preference for a delicious, crunchy weeknight favorite that’s both healthy and satisfying.
Reheating the Spicy Cajun Catfish Tacos in your air fryer preserves the catfish’s crispy texture while warming the components gently.
Reheating Steps:
- Preheat air fryer to 350°F (175°C) for 3 minutes.
- Remove lime slaw from tacos to prevent sogginess during reheating.
- Place catfish strips in a single layer in the air fryer basket without overcrowding.
- Heat for 4-5 minutes, flipping halfway, until hot and crispy.
- Warm corn tortillas separately for 1-2 minutes at 350°F if desired.
- Reassemble tacos with warm catfish and fresh lime slaw before serving.
Tips:
- Never reheat assembled tacos with slaw inside as it softens and changes flavor.
- Avoid stacking catfish pieces to ensure even heat distribution.
- Adjust reheating time based on your air fryer model’s power and basket size.
- This method maintains the recipe’s gluten-free, high-protein, and family-friendly qualities, keeping your tacos crisp and fresh.
What To Serve With This In The Air Fryer
Complement these bold and spicy Air Fryer Spicy Cajun Catfish Tacos with air fryer-friendly sides that balance heat and add texture—quick, healthy, and family-friendly options:
- Air Fryer Sweet Potato Fries: Naturally sweet and crispy, they contrast well with the spicy Cajun flavors for a gluten-free, low-fat side.
- Crispy Air Fryer Zucchini Chips: Thinly sliced and lightly seasoned for a crunchy veggie boost.
- Air Fryer Corn on the Cob: Brushed with olive oil, salt, and smoked paprika for a Southern-inspired complement.
- Quick Air Fryer Plantain Chips: Offer a sweet, crunchy contrast that pairs perfectly with lime slaw and spicy catfish.
- Air Fryer Stuffed Bell Peppers: Filled with quinoa and black beans, they provide a heartier side with flavors that enhance the tacos.
Serve with fresh lime wedges and chilled beverages like light beer or sparkling water with citrus to refresh the palate. These pairings keep your meal balanced and fully air fryer-friendly, ideal for weeknight dinners or family gatherings.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register