Airfryfeast

Seafood

Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw

By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished Mar 31, 2026 · Updated Jun 16, 2026
Southern American 22 mins air-fryer-friendlyspicyquickeasyhealthygluten-freehigh-proteincrispfamily-friendlyweeknight-dinner30-minutes-or-lesssavoryv2

Enjoy a healthy and crispy Southern American classic with these Air Fryer Spicy Cajun Catfish Tacos topped with a zesty lime slaw. This quick and easy gluten-free recipe is high in protein and bursting with bold Cajun spices, making it perfect for a family-friendly, weeknight seafood dinner.

Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw
Prep 10 min
Cook 12 min
Total 22 min
Servings 4
Difficulty easy
Cuisine Southern American

Recipe Details

Prep10 min
Cook12 min
Total22 min
Servings4
Difficultyeasy
CuisineSouthern American
Add To Favorites

Ingredients

Servings 4
  • 1 lb catfish fillets, cut into 4-5 strips
  • 1 tablespoon Cajun seasoning
  • 1 teaspoon smoked paprika
  • 1/2 teaspoon garlic powder
  • 1/2 teaspoon onion powder
  • 1/4 teaspoon cayenne pepper (adjust to taste)
  • 1/2 teaspoon salt
  • 1/4 teaspoon black pepper
  • 1 large egg
  • 1/2 cup gluten-free breadcrumbs or crushed gluten-free cornflakes
  • 1 tablespoon olive oil
  • 6 small corn tortillas, warmed
  • 1 cup shredded green cabbage
  • 1/2 cup shredded red cabbage
  • 1/4 cup grated carrot
  • 2 tablespoons finely chopped fresh cilantro
  • Juice of 1 lime
  • 1 tablespoon Greek yogurt or dairy-free yogurt
  • 1 teaspoon honey or maple syrup
  • Salt and pepper to taste
  • Lime wedges, for serving
Ingredients for Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw
Ingredients for Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw

Instructions

  1. Preheat your air fryer to 400°F (200°C) for 5 minutes.
  2. In a shallow bowl, whisk the egg until well beaten.
  3. In a separate bowl, combine Cajun seasoning, smoked paprika, garlic powder, onion powder, cayenne pepper, salt, black pepper, and gluten-free breadcrumbs.
  4. Dip each catfish strip into the beaten egg, then coat thoroughly with the seasoned breadcrumb mixture.
  5. Lightly spray or brush the catfish strips with olive oil to help them crisp up in the air fryer.
  6. Place the coated catfish strips in a single layer in the air fryer basket. Cook for 10-12 minutes, flipping halfway through, until golden brown and cooked through.
  7. While the catfish cooks, prepare the lime slaw by mixing shredded green cabbage, red cabbage, grated carrot, and cilantro in a bowl.
  8. In a small bowl, whisk together lime juice, yogurt, honey or maple syrup, salt, and pepper. Pour this dressing over the slaw and toss well to combine.
  9. Warm the corn tortillas on a dry skillet or in the air fryer for 1-2 minutes until pliable.
  10. Assemble the tacos by placing 1-2 catfish strips on each tortilla, topping with a generous scoop of lime slaw. Serve immediately with lime wedges on the side.
  11. Enjoy your spicy, crunchy, and flavorful Cajun catfish tacos!
Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw cooking in the air fryer
Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw cooking in the air fryer

Tips

Air Fryer Model Notes

Cook Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw in a single layer when possible. Basket models may need batches; oven-style models may need a tray rotation halfway through for even browning.

Crispiness Control

Pat the catfish fillets dry, avoid crowding, and use only a light coat of oil or sauce before cooking. Add wet sauces near the end when you want the outside to stay crisp.

Doneness Cues

Look for browned edges, a hot center, and the texture described in the instructions. For meat or seafood, confirm doneness with a thermometer instead of relying only on color.

Reheat In The Air Fryer

Reheat leftovers at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating.

Frequently Asked Questions

Can I make Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw ahead of time?
You can prep the ingredients and seasoning ahead, but air fry close to serving for the best texture.
How do I keep this recipe from turning soggy?
Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.
Can I adjust the seasoning?
Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.
How do I know the catfish fillets is done?
Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Ingredient Replacements

Customize your Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw to suit dietary needs or ingredient availability without sacrificing flavor or texture:

  • Catfish: Substitute with firm white fish like cod, tilapia, or haddock for similar texture and flavor.
  • Cajun Seasoning: For milder spice, replace with smoked paprika blends or chili powder mixed with oregano.
  • Gluten-Free Breadcrumbs: Use crushed gluten-free cornflakes, almond flour for low-carb diets, or crushed pork rinds for ketogenic options.
  • Egg: Replace with aquafaba (chickpea water) or a flax egg (1 tbsp ground flaxseed + 3 tbsp water) for vegan or egg-free versions.
  • Olive Oil: Avocado or light vegetable oil work well for a neutral flavor and high smoke point.
  • Corn Tortillas: Swap with lettuce wraps or low-carb tortillas for paleo or ketogenic diets.
  • Greek Yogurt: Use dairy-free yogurt alternatives, such as coconut or almond-based options, for a creamy, dairy-free dressing.
  • Honey or Maple Syrup: Substitute with agave syrup or sugar-free sweeteners to lower sugar content.

These substitutions maintain a quick, healthy, and delicious taco experience, preserving the signature crispiness and bold Cajun taste with a tangy lime slaw.

Storage

Store leftover Air Fryer Spicy Cajun Catfish Tacos with Lime Slaw in an airtight container in the refrigerator for up to 3 days. Cool the food before sealing so excess steam does not soften the texture.

Freeze only if the main ingredient and coating are freezer-friendly. Wrap tightly and freeze for up to 1 month, then thaw overnight in the refrigerator before reheating.

Reheat in the air fryer at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating for the best flavor.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from Airfryfeast.