Cooking Techniques
Airfryfeast
Air Fryer Lemon Basil Grilled Swordfish Steaks
By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished May 4, 2026 · Updated May 12, 2026
Mediterranean
20 mins
air-fryer-friendlyhealthyeasygluten-freehigh-proteinlow-fatquickfamily-friendlyweeknight-dinnercrispsavory30-minutes-or-less
Experience a vibrant Mediterranean-inspired dinner with these Air Fryer Lemon Basil Grilled Swordfish Steaks. This quick and healthy recipe combines fresh lemon juice and fragrant basil to elevate the naturally meaty texture of swordfish, cooked to perfection with a delightfully crisp exterior using your air fryer. Ideal for family dinners or nutritious weeknight meals, this dish is gluten-free, low-fat, high-protein, and packed with savory flavor.
Prep
10 min
Cook
10 min
Total
20 min
Servings
2
Difficulty
easy
Cuisine
Mediterranean
Ingredients
Servings
2
- 2 swordfish steaks (about 6 oz each), about 1-inch thick
- 2 tablespoons freshly squeezed lemon juice
- 1 tablespoon extra virgin olive oil
- 2 cloves garlic, minced
- 2 tablespoons fresh basil leaves, finely chopped
- 1/2 teaspoon sea salt
- 1/4 teaspoon freshly ground black pepper
- 1/4 teaspoon smoked paprika (optional, for subtle smoky flavor)
- Lemon wedges, for serving
- Fresh basil leaves, for garnish
Instructions
-
In a small bowl, whisk together lemon juice, olive oil, minced garlic, chopped basil, sea salt, black pepper, and smoked paprika if using.
-
Place the swordfish steaks in a shallow dish and pour the marinade over them. Turn steaks to coat evenly. Let marinate for 10-15 minutes at room temperature, but no longer than 20 minutes to prevent the lemon juice from 'cooking' the fish.
-
Preheat your air fryer to 400°F (200°C) for about 5 minutes.
-
Lightly spray or brush the air fryer basket with oil to prevent sticking.
-
Remove swordfish steaks from marinade, letting excess drip off, and arrange in a single layer in the basket. Avoid overcrowding; cook in batches if needed.
-
Air fry for 8-10 minutes, flipping halfway through, until the fish is opaque and flakes easily with a fork. The edges should be crisp and golden brown.
-
Carefully remove the steaks and let rest for 2 minutes.
-
Serve immediately, garnished with fresh basil leaves and lemon wedges for an extra citrus burst.
-
Pair with a light Mediterranean salad or your favorite seasonal air fryer sides for a balanced, healthy meal.
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
If swordfish is unavailable or you'd like alternatives, try these seafood options that air fry well and complement the lemon basil marinade:
- Halibut or Cod: Firm white fish steaks with mild flavor, ideal for a quick and healthy air fryer meal.
- Salmon: Rich in omega-3 fatty acids, salmon offers a slightly fattier texture that pairs beautifully with lemon and basil.
- Tilapia: A budget-friendly, low-fat choice that cooks quickly and holds flavors well.
For oil substitutions, use avocado oil or grapeseed oil to maintain a light, low-fat, gluten-free profile.
If fresh basil is unavailable, replace with about one-third the amount of dried basil or experiment with fresh oregano or parsley for a different but complementary herbal note.
To keep the recipe gluten-free and healthy, avoid breading. Rely on the marinade and air fryer's crisping for texture and flavor.
Air Fryer Model Notes
This Air Fryer Lemon Basil Grilled Swordfish Steaks recipe is crafted to work well with most standard air fryer models. Tailoring cooking techniques for your specific air fryer can optimize results:
- Basket Size & Capacity: Smaller baskets may require cooking in batches to avoid overcrowding, which prevents uneven cooking or soggy edges. Larger baskets let you cook both steaks simultaneously for even crispiness and time savings.
- Temperature Accuracy & Control: Digital controls with precise temperature settings are ideal for delicate seafood. If your air fryer runs hotter than indicated, reduce cooking time slightly or lower temperature by 10°F to keep fish moist.
- Airflow & Basket Design: Well-ventilated baskets promote better hot air circulation, leading to crispier exteriors. Less vented designs may require flipping more frequently or slightly longer cook times for even browning.
- Preset Functions: While 'fish' or 'seafood' presets can be convenient, manual control at 400°F for 8-10 minutes with a flip halfway ensures better control based on steak thickness and air fryer behavior.
- Non-Stick Coating and Basket Material: Lightly spraying or brushing oil on the basket prevents sticking and supports crisp edges. If your basket has worn coating, consider using reusable air fryer parchment liners suitable for fish to protect your equipment and ensure non-stick cooking.
Following these tips specific to your air fryer model will help you create juicy, flavor-packed swordfish steaks with a deliciously crisp finish every time.
Crispiness Control
Adjust the crispiness of these Air Fryer Lemon Basil Grilled Swordfish Steaks to suit your preference while maintaining their tender, meaty interior:
- Light Crisp: Cook at 400°F (200°C) for 8 minutes, flipping once halfway. This yields a gently crisp edge and juicy center.
- Max Crisp: Extend cooking up to 10 minutes, flipping at 5 minutes for a deeply browned, crisp crust while locking in moisture.
- Avoid Overcrowding: Arrange steaks in a single layer with space around them for optimal airflow and even crisping.
- Use Light Oil Application: Brushing the basket with a small amount of olive oil enhances crisping and prevents sticking without adding unnecessary fat.
- Rest After Cooking: Allow steaks to rest for 2 minutes off heat to set the crisp exterior while keeping the interior moist and flavorful.
By tailoring cooking time with consistent 400°F heat and proper spacing, you can achieve your ideal crispiness for a satisfying Mediterranean seafood experience that's nutritious and delicious.
Reheat In The Air Fryer
Reheat your Lemon Basil Grilled Swordfish Steaks in the air fryer to preserve their moisture and crisp exterior by following these steps:
- Preheat the air fryer to 350°F (175°C) for 3-5 minutes to gently warm without overcooking.
- Lightly spray or brush the air fryer basket with non-stick spray or olive oil to prevent sticking.
- Place swordfish steaks in a single layer in the basket, avoiding overcrowding for even reheating.
- Heat for 4-5 minutes, flipping halfway to warm evenly.
- Check that steaks are heated through but avoid extended reheating to prevent drying.
Pro Tips:
- Brush leftover marinade or lemon juice lightly on the steaks before reheating for extra moisture and flavor.
- Allow the steaks to rest 1-2 minutes post-reheating to redistribute juices.
- Serve with fresh lemon wedges and chopped basil for a vibrant finish.
- This method maintains the dish’s healthy, high-protein, low-fat, and gluten-free qualities while keeping it quick and family-friendly.
What To Serve With This In The Air Fryer
This fresh, Mediterranean-inspired swordfish pairs beautifully with other light, air fryer-friendly sides to create a balanced, healthy meal:
- Air Fryer Greek-Style Roasted Vegetables: Zucchini, cherry tomatoes, bell peppers, and red onion tossed with olive oil, oregano, and garlic, air fried until tender and slightly caramelized for a flavorful staple.
- Air Fryer Garlic Parmesan Asparagus: Asparagus spears lightly coated with olive oil, garlic powder, and Parmesan cheese crispen perfectly for a savory side.
- Air Fryer Lemon Herb Potatoes: Baby potatoes seasoned with lemon zest, rosemary, and sea salt become crispy and golden, complementing the citrus notes in the swordfish.
- Fresh Mediterranean Salad: Chopped cucumbers, tomatoes, kalamata olives, red onion, and feta cheese dressed lightly with lemon vinaigrette offer a refreshing crunch.
- Air Fryer Stuffed Portobello Mushrooms: Filled with spinach, herbs, and cheese (or dairy-free alternatives) for a delicious and earthy side.
Finish with lemon wedges and fresh basil on both the fish and sides to unify the flavors. These pairings ensure a gluten-free, low-fat meal that’s quick, easy, and perfect for weeknight dinners or family meals.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register