Can I make Air Fryer Lemon Basil Grilled Swordfish Steaks ahead of time?

You can prep the ingredients and seasoning ahead, but air fry close to serving for the best texture.

How do I keep this recipe from turning soggy?

Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.

Can I adjust the seasoning?

Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.

How do I know the swordfish steaks (about 6 oz each) is done?

Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Back to Recipes

Seafood

Air Fryer Lemon Basil Grilled Swordfish Steaks

Name: Air Fryer Lemon Basil Grilled Swordfish Steaks
Prep time: 10 min
Cook time: 10 min
Total time: 20 min
Yield: 2 servings
Cuisine: Mediterranean
Ingredients: 2 swordfish steaks (about 6 oz each), about 1-inch thick; 2 tablespoons freshly squeezed lemon juice; 1 tablespoon extra virgin olive oil; 2 cloves garlic, minced; 2 tablespoons fresh basil leaves, finely chopped; 1/2 teaspoon sea salt; 1/4 teaspoon freshly ground black pepper; 1/4 teaspoon smoked paprika (optional, for subtle smoky flavor); Lemon wedges, for serving; Fresh basil leaves, for garnish

By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished May 4, 2026 · Updated Jun 17, 2026

Mediterranean 20 mins air-fryer-friendlyhealthyeasygluten-freehigh-proteinlow-fatquickfamily-friendlyweeknight-dinnercrispsavory30-minutes-or-lessv2

Experience a vibrant Mediterranean-inspired dinner with these Air Fryer Lemon Basil Grilled Swordfish Steaks. This quick and healthy recipe combines fresh lemon juice and fragrant basil to elevate the naturally meaty texture of swordfish, cooked to perfection with a delightfully crisp exterior using your air fryer. Ideal for family dinners or nutritious weeknight meals, this dish is gluten-free, low-fat, high-protein, and packed with savory flavor.

Prep 10 min

Cook 10 min

Total 20 min

Servings 2

Difficulty easy

Cuisine Mediterranean

Ingredients

Servings 2

2 swordfish steaks (about 6 oz each), about 1-inch thick
2 tablespoons freshly squeezed lemon juice
1 tablespoon extra virgin olive oil
2 cloves garlic, minced
2 tablespoons fresh basil leaves, finely chopped
1/2 teaspoon sea salt
1/4 teaspoon freshly ground black pepper
1/4 teaspoon smoked paprika (optional, for subtle smoky flavor)
Lemon wedges, for serving
Fresh basil leaves, for garnish

Ingredients for Air Fryer Lemon Basil Grilled Swordfish Steaks

Instructions

In a small bowl, whisk together lemon juice, olive oil, minced garlic, chopped basil, sea salt, black pepper, and smoked paprika if using.
Place the swordfish steaks in a shallow dish and pour the marinade over them. Turn steaks to coat evenly. Let marinate for 10-15 minutes at room temperature, but no longer than 20 minutes to prevent the lemon juice from 'cooking' the fish.
Preheat your air fryer to 400°F (200°C) for about 5 minutes.
Lightly spray or brush the air fryer basket with oil to prevent sticking.
Remove swordfish steaks from marinade, letting excess drip off, and arrange in a single layer in the basket. Avoid overcrowding; cook in batches if needed.
Air fry for 8-10 minutes, flipping halfway through, until the fish is opaque and flakes easily with a fork. The edges should be crisp and golden brown.
Carefully remove the steaks and let rest for 2 minutes.
Serve immediately, garnished with fresh basil leaves and lemon wedges for an extra citrus burst.
Pair with a light Mediterranean salad or your favorite seasonal air fryer sides for a balanced, healthy meal.

Air Fryer Lemon Basil Grilled Swordfish Steaks cooking in the air fryer

Tips

Air Fryer Model Notes

Cook Air Fryer Lemon Basil Grilled Swordfish Steaks in a single layer when possible. Basket models may need batches; oven-style models may need a tray rotation halfway through for even browning.

Crispiness Control

Pat the swordfish steaks dry, avoid crowding, and use only a light coat of oil or sauce before cooking. Add wet sauces near the end when you want the outside to stay crisp.

Doneness Cues

Look for browned edges, a hot center, and the texture described in the instructions. For meat or seafood, confirm doneness with a thermometer instead of relying only on color.

Reheat In The Air Fryer

Reheat leftovers at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating.

Frequently Asked Questions

Can I make Air Fryer Lemon Basil Grilled Swordfish Steaks ahead of time?: You can prep the ingredients and seasoning ahead, but air fry close to serving for the best texture.
How do I keep this recipe from turning soggy?: Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.
Can I adjust the seasoning?: Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.
How do I know the swordfish steaks (about 6 oz each) is done?: Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Ingredient Replacements

If swordfish is unavailable or you'd like alternatives, try these seafood options that air fry well and complement the lemon basil marinade:

Halibut or Cod: Firm white fish steaks with mild flavor, ideal for a quick and healthy air fryer meal.
Salmon: Rich in omega-3 fatty acids, salmon offers a slightly fattier texture that pairs beautifully with lemon and basil.
Tilapia: A budget-friendly, low-fat choice that cooks quickly and holds flavors well.

For oil substitutions, use avocado oil or grapeseed oil to maintain a light, low-fat, gluten-free profile.

If fresh basil is unavailable, replace with about one-third the amount of dried basil or experiment with fresh oregano or parsley for a different but complementary herbal note.

To keep the recipe gluten-free and healthy, avoid breading. Rely on the marinade and air fryer's crisping for texture and flavor.

Storage

Store leftover Air Fryer Lemon Basil Grilled Swordfish Steaks in an airtight container in the refrigerator for up to 3 days. Cool the food before sealing so excess steam does not soften the texture.

Freeze only if the main ingredient and coating are freezer-friendly. Wrap tightly and freeze for up to 1 month, then thaw overnight in the refrigerator before reheating.

Reheat in the air fryer at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating for the best flavor.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Air Fryer Lemon Basil Grilled Swordfish Steaks

Recipe Details

Ingredients

Instructions