Can I make Air Fryer Crispy Mediterranean Grilled Octopus ahead of time?

You can prep the ingredients and seasoning ahead, but air fry close to serving for the best texture.

How do I keep this recipe from turning soggy?

Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.

Can I adjust the seasoning?

Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.

How do I know the pre-cooked octopus tentacles is done?

Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Back to Recipes

Seafood

Air Fryer Crispy Mediterranean Grilled Octopus

Name: Air Fryer Crispy Mediterranean Grilled Octopus
Prep time: 10 min
Cook time: 18 min
Total time: 28 min
Yield: 4 servings
Cuisine: Mediterranean
Ingredients: 1 lb pre-cooked octopus tentacles, thawed if frozen; 2 tablespoons extra virgin olive oil; 3 garlic cloves, minced; 1 teaspoon dried oregano; 1 teaspoon smoked paprika; 1/2 teaspoon sea salt; 1/4 teaspoon freshly ground black pepper; 1 lemon, zested and juiced; 1 tablespoon fresh parsley, finely chopped (optional, for garnish); Lemon wedges, for serving

By Airfryfeast Test KitchenReviewed by Airfryfeast Editorial TeamPublished Mar 31, 2026 · Updated Jun 16, 2026

Mediterranean 28 mins air-fryer-friendlyhealthygluten-freehigh-proteincrispeasyfamily-friendlysavoryweeknight-dinner30-minutes-or-lessv2

Savor tender, crisp Mediterranean grilled octopus infused with garlic, lemon, and herbs, perfectly cooked in the air fryer for a healthy, gluten-free, high-protein seafood dish ready in under 30 minutes.

Air Fryer Crispy Mediterranean Grilled Octopus

Prep 10 min

Cook 18 min

Total 28 min

Servings 4

Difficulty easy

Cuisine Mediterranean

Ingredients

Servings 4

1 lb pre-cooked octopus tentacles, thawed if frozen
2 tablespoons extra virgin olive oil
3 garlic cloves, minced
1 teaspoon dried oregano
1 teaspoon smoked paprika
1/2 teaspoon sea salt
1/4 teaspoon freshly ground black pepper
1 lemon, zested and juiced
1 tablespoon fresh parsley, finely chopped (optional, for garnish)
Lemon wedges, for serving

Ingredients for Air Fryer Crispy Mediterranean Grilled Octopus

Instructions

Preheat your air fryer to 400°F (200°C) for about 5 minutes.
In a mixing bowl, combine the olive oil, minced garlic, dried oregano, smoked paprika, sea salt, black pepper, lemon zest, and lemon juice. Stir well to create a flavorful Mediterranean marinade.
Cut the pre-cooked octopus tentacles into 2-inch pieces and add to the marinade. Toss gently to coat all pieces evenly.
Let the octopus marinate for 5 minutes at room temperature to absorb the vibrant flavors.
Arrange the marinated octopus pieces in a single layer in your air fryer basket. Avoid overcrowding to ensure even crisping.
Cook for 9 minutes at 400°F (200°C), then shake the basket or carefully flip each piece with tongs.
Continue cooking for an additional 9 minutes or until the octopus edges are golden and crispy to your liking.
Remove the octopus from the air fryer and transfer to a serving plate. Garnish with fresh parsley if desired and serve immediately with lemon wedges.
Enjoy your crispy Mediterranean grilled octopus as a savory main course or an impressive seafood appetizer.

Air Fryer Crispy Mediterranean Grilled Octopus cooking in the air fryer

Tips

Air Fryer Model Notes

Cook Air Fryer Crispy Mediterranean Grilled Octopus in a single layer when possible. Basket models may need batches; oven-style models may need a tray rotation halfway through for even browning.

Crispiness Control

Pat the pre-cooked octopus tentacles dry, avoid crowding, and use only a light coat of oil or sauce before cooking. Add wet sauces near the end when you want the outside to stay crisp.

Doneness Cues

Look for browned edges, a hot center, and the texture described in the instructions. For meat or seafood, confirm doneness with a thermometer instead of relying only on color.

Reheat In The Air Fryer

Reheat leftovers at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating.

Frequently Asked Questions

Can I make Air Fryer Crispy Mediterranean Grilled Octopus ahead of time?: You can prep the ingredients and seasoning ahead, but air fry close to serving for the best texture.
How do I keep this recipe from turning soggy?: Cook in a single layer, leave space for airflow, and avoid adding too much oil or sauce before the food has crisped.
Can I adjust the seasoning?: Yes. Keep the same cooking method and adjust salt, spice, herbs, citrus, or sauce to match your taste.
How do I know the pre-cooked octopus tentacles is done?: Use the visual cues in the instructions first: the outside should be browned or crisp and the center should be hot and tender. For meat or seafood, confirm doneness with a food thermometer.

Ingredient Replacements

If pre-cooked octopus tentacles aren't available or you'd prefer a different protein, try these smart substitutions that maintain Mediterranean flavors and air fryer suitability:

Octopus Tentacles: Use pre-cooked squid rings or calamari for similar texture and quick air fryer cooking.
Extra Virgin Olive Oil: Swap with avocado oil or grapeseed oil to keep light, healthy fats compatible with air frying and Mediterranean tastes.
Dried Oregano: Replace with dried thyme or rosemary for a different but complementary aromatic profile.
Smoked Paprika: Try sweet paprika plus a pinch of chili powder if you want more heat and smokiness.
Fresh Lemon Juice and Zest: Use lime juice and zest for a citrus variation that maintains bright acidity.

For vegetarian or vegan adaptations, consider air frying crispy seasoned mushrooms or heart of palm pieces using the same marinade and method. This keeps the dish crispy, savory, and aromatic while catering to plant-based diets.

Storage

Store leftover Air Fryer Crispy Mediterranean Grilled Octopus in an airtight container in the refrigerator for up to 3 days. Cool the food before sealing so excess steam does not soften the texture.

Freeze only if the main ingredient and coating are freezer-friendly. Wrap tightly and freeze for up to 1 month, then thaw overnight in the refrigerator before reheating.

Reheat in the air fryer at 325 F to 350 F in a single layer until hot and crisp again. Add fresh herbs, citrus, or sauce after reheating for the best flavor.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Air Fryer Crispy Mediterranean Grilled Octopus

Recipe Details

Ingredients

Instructions